CAZyme Information: SAPIO_CDS10067-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS10067-t41_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
429	JOWA01000154|CGC6	48421.55	4.3416

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000154:1092869-1094494(+)

Full Sequence      

MWLPGLVYGFGLLSTVRGTIIQNGQVRETNYLDTRIDLVDDSYTTYANDASEISYLGRWD
SKKVSWWAAPGIRFGFTGQTVAVTFGEHTIDGTLVGYRLSGLDWQFTNVTSGGTHLFISP
EVQGVELTAPVSPSTFEMRVTNWGYGVQIDSVHVSEGEELVKLPRQPRFIEFIGDSLSAG
MYNSYEALSGFAYGVGQGLGNTDYSITAYPGICVSDQDCWGNTRGQSHQWFYTTDNSWRS
KEIWGDEPEPWDFGKQQDADLVIINLGTNDANAANNVTKETYVEHYKRLIQGIHGVWPDA
QVVVMQMWQGFYQDGNSYAQNADLREEVYSVYKYFNSEEYLSNAVIWDGINEKATKTETS
IEPFVHFFNTTGILQHNDIAPQWHPTDVGQIKVASHLIQFITQKFGWYLYATGPEVFADT
LYWNDQSGY

Enzyme Prediction     

No EC number prediction in SAPIO_CDS10067-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	170	401	5.2e-23	0.9904306220095693

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238869	Endoglucanase_E_like	4.50e-36	170	402	2	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
404371	Lipase_GDSL_2	5.65e-12	172	333	1	134	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	6.91e-12	170	400	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
395531	Lipase_GDSL	5.18e-04	255	397	75	224	GDSL-like Lipase/Acylhydrolase.
238874	FeeA_FeeB_like	0.001	172	304	7	111	SGNH_hydrolase subfamily, FeeA, FeeB and similar esterases/lipases. FeeA and FeeB are part of a biosynthetic gene cluster and may participate in the biosynthesis of long-chain N-acyltyrosines by providing saturated and unsaturated fatty acids, which it turn are loaded onto the acyl carrier protein FeeL. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC83578.1|CE0	1.07e-214	1	429	2	400
VBB73265.1|CE0	2.16e-211	7	429	9	436
CDP24093.1|CE0	4.36e-211	7	429	9	436
EAA35351.3|CE0	2.52e-209	1	429	1	432
AEO54717.1|CE0	3.03e-208	7	429	9	433

PDB Hits     

SAPIO_CDS10067-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

SAPIO_CDS10067-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.362290	0.637706	CS pos: 18-19. Pr: 0.5994

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS10067-t41_1-p1.