CAZyme Information: SAPIO_CDS0862-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS0862-t41_1-p1
• CAZy Family: AA3
• CAZyme Description: Uncharacterized protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
452	JOWA01000033|CGC4	52201.81	6.1120

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000033:1015529-1017119(-)

Full Sequence      

MPRHHPGSFANGYPRGGTFDISPHRFEPRSSTPAFRRRRALLTRAIYALVAIIVFGYFVW
PRGPVVSVISLGLLTVGGDSQLETVRYYDLSNVQGTARGWEREERILFCVPLRDAEVHLP
MFFSHLRNFTYPHHLVDLAFLVSDSKDRTLQVVIDSMNDIQSDEDITQHYGEVSIIEKDF
GQKVNQDVESRHGFAAQASRRKLMAQARNWLLSATLRPYHSWVYWRDVDVQTAPFTILED
LMRHNKDVIVPNVWRPLPDWLGGEQPYDLNSWQESETALALADTLDEDAVIVEGYAEYAT
WRPHLAYLRDPYGDPDMEMEIDGVGGVSILAKARVFRSGVHFPAFSFEKHAETEGFGKMA
KRMGYSVVGLPHYTIWHLYEPSVDDIRHMEEMEKERLAREKEEQEKAERAKKLKEEFGDT
NNQWEKDKSEMENLAKQKKDQPHHRGEATVDR

Enzyme Prediction     

No EC number prediction in SAPIO_CDS0862-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	83	346	1.1e-122	0.9888059701492538

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	1.07e-156	84	346	1	265	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.
404741	DUF4207	0.001	387	449	97	152	Domain of unknown function (DUF4207). This family is found in eukaryotes; it has several conserved tryptophan residues. The function is not known.
406200	DUF4670	0.003	389	447	345	404	Domain of unknown function (DUF4670). This family of proteins is found in eukaryotes. Proteins in this family are typically between 373 and 763 amino acids in length.
406371	Casc1_N	0.008	390	437	4	44	Cancer susceptibility candidate 1 N-terminus. This presumed domain is functionally uncharacterized. This domain family is found in eukaryotes, and is approximately 200 amino acids in length. The family is found in association with pfam12366. There are two completely conserved residues (N and W) that may be functionally important.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT73465.1|GT62	1.15e-265	1	439	2	440
QKD59569.1|GT62	1.79e-265	1	439	14	452
CEI62922.1|GT62	8.50e-265	1	439	14	452
UNI20376.1|GT62	2.34e-264	1	439	2	440
UQC75883.1|GT62	2.97e-264	1	435	13	447

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	3.50e-62	85	382	6	304	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74745|ANP1_SCHPO	1.02e-163	16	399	11	393	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|P32629|ANP1_YEAST	3.16e-162	84	431	61	408	Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ANP1 PE=1 SV=3
sp|P23642|VAN1_YEAST	1.04e-126	84	396	171	530	Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAN1 PE=1 SV=3
sp|Q00314|VAN1_CANAX	4.21e-122	79	396	70	437	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1
sp|P53697|MNN9_CANAL	2.70e-61	85	380	73	368	Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN9 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999971	0.000049

TMHMM  Annotations     

Start	End
41	60