CAZyme Information: SAPIO_CDS0762-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS0762-t41_1-p1
• CAZy Family: AA3
• CAZyme Description: Choline dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
620	JOWA01000033|CGC3	67039.57	4.2438

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000033:656594-658526(+)

Full Sequence      

MHAKAITPLFLLAAGAVLAAPAARQETSDEYDYIVVGSGPGGGPLAVNLAKAGHSVLLLE
AGDTSAGGSSQYPPEITWDFFVKHFEDDEKNKANDYGVWKTVEGRYWVGKDNPPEGAEFL
GIYYPRGATVGGSSMINAMATWLPTDSDWNYVVEVTGDESWKAENMREIFTRIEKNNYLP
EGTPGHGFDGWFQTMMTSGFGPPGSGGDGPANPVTESMASELGLDPADVPELVSSDPNAL
DPDRDTTQGIYGLPRHQRANGQRYSSRHYILESIEEGIPLTLSVNSLATKVLFETSESEE
AKPKAIGVEYLEGKAIYGADPRRGPDSEGTKKTATARREVIISGGTFNTPQILMLSGIGD
PEQLEQFDIPVLVEATGVGTSLMDNQEMPVVGQASGTVGFGDPGFIMIQTDHATYDERDM
FLMHNSGGVFRGFWPSNQTNELPSEVPRVYSTSMVKQHPLNRAGYVRLQSADPLDTPDIN
FNLYVEGSETDLGGMRDSIAWVRRVYANVAAPAGPIEPLEPPCPSGITEDGHCTDESEDD
EWIIAHTFGHHPTSTVRIGADDDPTAVLDSKFRVRGVEGLRVVDASVFPRIPGVFPVVAT
FIISQKATDTILEELAAEME

Enzyme Prediction     

No EC number prediction in SAPIO_CDS0762-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	25	615	1.6e-72	0.5129449838187702

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	7.47e-53	45	614	22	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	6.99e-49	27	612	2	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	4.36e-31	464	607	5	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.58e-19	122	359	19	203	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	5.26e-15	263	596	216	561	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDP31667.1|AA3	1.65e-217	31	615	60	642
VBB86080.1|AA3	1.65e-217	31	615	60	642
QRC93226.1|AA3	4.92e-188	25	614	25	665
CAE7177936.1|AA3	6.18e-188	5	615	9	673
QYT06228.1|AA3_2	2.33e-187	6	604	10	590

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NNE_A	2.04e-34	25	618	7	533	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	2.04e-34	25	618	7	533	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
2JBV_A	5.05e-34	25	618	7	533	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
4UDP_A	2.14e-28	27	614	2	530	Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDP_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDQ_A Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688],4UDQ_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688]
6F97_A	2.14e-28	27	614	2	530	Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688],6F97_B Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7FKL6|BETA_YERP3	1.65e-40	30	611	2	531	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) OX=349747 GN=betA PE=3 SV=1
sp|B1JSR0|BETA_YERPY	1.65e-40	30	611	2	531	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) OX=502800 GN=betA PE=3 SV=1
sp|Q1CFR7|BETA_YERPN	7.76e-40	30	611	2	531	Oxygen-dependent choline dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Nepal516) OX=377628 GN=betA PE=3 SV=1
sp|Q1C932|BETA_YERPA	7.76e-40	30	611	2	531	Oxygen-dependent choline dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Antiqua) OX=360102 GN=betA PE=3 SV=1
sp|Q8ZGW0|BETA_YERPE	7.76e-40	30	611	2	531	Oxygen-dependent choline dehydrogenase OS=Yersinia pestis OX=632 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000417	0.999567	CS pos: 24-25. Pr: 0.8912

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS0762-t41_1-p1.