CAZyme Information: SAPIO_CDS0725-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS0725-t41_1-p1
• CAZy Family: GT8
• CAZyme Description: Uncharacterized protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
407		43277.44	6.0780

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000033:535585-536874(-)

Full Sequence      

MRFSSLHILAAGLLSGPGLVSAARHVRRGVVCYFEMPAASGDTCDSLASSWGISVDLFKN
INPGVTCPNLEAGKSYCVIGEYTPDATSTSTSSQPQSTTSKTSTTTTKSSTTLSTTTSPS
ATPSIYPTMPGIAENCDRFYKIKSGDTCDAIAQSNSITLDQLRSWNTEINASCSNLWLDY
YICTHVPGAVQPSTTSTAPTPSNSPTMPGIAENCDSFYKIKSGDTCDAIASSNGITVAQL
RSWNTEINAGCSNLWLDYYICTHVPGAAQPSTTSSAPTPSNSPVLPGAVSNCNKWYKIVS
GDTCEKIAAKNTITVDQFRSWNTQINTSCNNLWLDYYACVGVPGAATPMPDIVSNCSRFY
LVVSGDSCDVIAQKNGITVANFKRWNPFINAACTNLWANALVCTNAP

Enzyme Prediction     

EC	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
180536	PRK06347	1.25e-17	138	386	331	576	1,4-beta-N-acetylmuramoylhydrolase.
212030	LysM	1.52e-10	217	260	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
212030	LysM	3.50e-10	138	182	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
212030	LysM	7.07e-10	358	397	1	40	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
212030	LysM	8.19e-10	294	337	1	44	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS16287.1|CBM50	1.62e-105	7	342	5	339
BCS04718.1|CBM50	1.62e-105	7	342	5	339
BCS23655.1|CBM50	3.59e-104	7	342	5	332
UNI17016.1|CBM50	8.91e-88	21	342	20	325
QQK44150.1|CBM50	2.68e-83	27	403	28	423

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PXV_A	2.72e-06	218	261	5	46	Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],4PXV_B Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],4PXV_C Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],4PXV_D Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],5YLG_A Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],5YLG_B Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],5YLG_C Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],5YLG_D Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis]
5BUM_A	9.79e-06	32	78	2	48	Crystal Structure of LysM domain from Equisetum arvense chitinase A [Equisetum arvense],5BUM_B Crystal Structure of LysM domain from Equisetum arvense chitinase A [Equisetum arvense]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ALG0|LYSM1_ARTBC	7.22e-71	40	403	76	454	LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05157 PE=1 SV=1
sp|D4B4P8|LYSM2_ARTBC	8.22e-20	32	199	29	192	LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03438 PE=3 SV=1
sp|P37710|ALYS_ENTFA	4.13e-14	139	386	362	593	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
sp|D4B5F9|PGDA_ARTBC	6.01e-14	286	342	381	437	Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03699 PE=1 SV=2
sp|D4AZ68|LYSM3_ARTBC	9.54e-14	127	264	258	408	LysM domain-containing protein ARB_01488 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01488 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000266	0.999727	CS pos: 22-23. Pr: 0.9758

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS0725-t41_1-p1.