CAZyme Information: SAPIO_CDS0443-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS0443-t41_1-p1
• CAZy Family: AA3
• CAZyme Description: 1,3-beta-glucanosyltransferase gel4

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
517		56295.95	4.4611

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000022:494030-495768(+)

Full Sequence      

MTLSKTLVSALLASTVAALEPIVIKGSKFFYENGTQFYIKGIAYQQNTGAAGAGVQDAKF
ADPLANPAACRRDVPLLKELGTNTIRTYAINPSADHSVCMRLLEEAGIYVISDLGEPNLS
IETDAPLWDLDLFGRYKSVVDELSKYDNVIGFFAGNEVTTNKTNTPASAYVKAAVRDTKA
YIKEKGVNLYVGYAANDDPDVRRDIAHYFNCGDDQSQAIDFWGYNIYQWCGESTLEKSGY
SKQIDFFKNYSVPVFFAEYGCNTGKDGAESRIFQETTALYGDEMTSVFSGGIVYMYFQEA
NDFGLVELNGNTATRMKNFKALADRISKVDPTTIDSDQYKPSNVPQTCPPVSDVWEVSGD
NLPITPDQKVCDCMFAGLSCKASPTLDEKNYGDIFNFVCGTKGRPCDAINGNATSGKYGV
FSMCNAQQKLGYVLDRYYKNQNNAADACDFSGQATLVTPTKTDAECEQKLTEASQAASAA
NGDSGNNKKEDDSSAVRFAAAGLYVAVAFVFGTMMVL

Enzyme Prediction     

EC	2.4.1.-:3	2.4.1.-:33

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH72	17	328	2.6e-122	0.9871794871794872
CBM43	379	466	1.4e-19	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397351	Glyco_hydro_72	2.25e-144	11	330	1	315	Glucanosyltransferase. This is a family of glycosylphosphatidylinositol-anchored beta(1-3)glucanosyltransferases. The active site residues in the Aspergillus fumigatus example are the two glutamate residues at 160 and 261.
400371	X8	3.15e-26	378	455	1	76	X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains.
197867	X8	3.42e-16	378	466	1	83	Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges.
395098	Cellulase	0.006	76	260	32	237	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO56681.1|CBM43|GH72	5.38e-213	9	517	12	532
UNI17908.1|CBM43|GH72	1.50e-208	1	507	1	514
VBB75493.1|CBM43|GH72	3.63e-204	1	484	1	485
CDP25416.1|CBM43|GH72	2.08e-203	1	484	1	485
CAP73016.1|CBM43|GH72	2.08e-203	1	484	1	485

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W62_A	8.85e-111	22	438	36	456	Saccharomyces cerevisiae Gas2p in complex with laminaripentaose [Saccharomyces cerevisiae],2W63_A Saccharomyces Cerevisiae Gas2p In Complex With Laminaritriose And Laminaritetraose [Saccharomyces cerevisiae],5O9O_A Crystal structure of ScGas2 in complex with compound 7. [Saccharomyces cerevisiae S288C],5O9P_A Crystal structure of Gas2 in complex with compound 10 [Saccharomyces cerevisiae S288C],5O9Q_A Crystal structure of ScGas2 in complex with compound 6 [Saccharomyces cerevisiae S288C],5O9R_A Crystal structure of ScGas2 in complex with compound 9 [Saccharomyces cerevisiae S288C],5O9Y_A Crystal structure of ScGas2 in complex with compound 11 [Saccharomyces cerevisiae S288C],5OA2_A Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_B Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_C Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA6_A Crystal structure of ScGas2 in complex with compound 12 [Saccharomyces cerevisiae S288C]
2W61_A	2.48e-110	22	438	36	456	Saccharomyces cerevisiae Gas2p apostructure (E176Q mutant) [Saccharomyces cerevisiae]
5FIH_A	2.48e-110	22	438	36	456	SACCHAROMYCES CEREVISIAE GAS2P (E176Q MUTANT) IN COMPLEX WITH LAMINARITETRAOSE AND LAMINARIPENTAOSE [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ATC3|GAS1_ARTBC	3.42e-164	9	503	10	523	1,3-beta-glucanosyltransferase ARB_07487 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07487 PE=1 SV=1
sp|P0C955|GEL3_ASPFU	1.13e-159	23	476	17	471	1,3-beta-glucanosyltransferase gel3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gel3 PE=3 SV=1
sp|B0XT09|GEL3_ASPFC	1.24e-159	23	476	17	471	1,3-beta-glucanosyltransferase gel3 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=gel3 PE=1 SV=1
sp|P0C956|GEL4_ASPFU	1.59e-152	26	476	43	489	1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gel4 PE=3 SV=1
sp|B0XVI5|GEL4_ASPFC	1.59e-152	26	476	43	489	1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=gel4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000319	0.999671	CS pos: 18-19. Pr: 0.9639

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS0443-t41_1-p1.