CAZyme Information: SAPIO_CDS0352-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS0352-t41_1-p1
• CAZy Family: AA13|CBM20
• CAZyme Description: putative fad binding domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
628		69607.66	5.1958

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000022:148141-150184(+)

Full Sequence      

MRPPVQWLGYAALASLVLSAPADFETTQLTDQDIGDFTALSFGNRNQRWRPRSSCKAFPG
TDDWPSEREWGRLNRTLEGALLRPNPPAIVCYDGPEYNEAKCKDLILHAGDSHFYIDDPL
TVLSQWLQGSTCLPGLSPKGNCTRGGYPEYVVNVTRVKHVQAAVNFARNNNVRLVIKNTG
HDFGGRSVGAGSLSVWTHHLKSFEFLPEYRMGRYKGMAVRYGAGLEAWELYNYMAEHNIS
IPAAGGRTVGANGGWFASGGHGNLASFYGLGCDQALEIHAVTADGDYVVANPYENEDLFY
ALRGGGGSTYAIVTSVVMKAYPPTTLIRASLTVSSKTGANASTSYRVDDPEVFWEAMKVY
FRFSAVIVDAGGVDWSYLTPMGNETYTFTVGMTFPNRTTEEVEEILAPLYVDLRNVGIDL
DVPPNLAPTPYASHSEAPAAPLADTRYRSRLFPRKNWDDDDLFAKTFDAIRKSIEAGYTF
HALAISATKEVAGWPGRHGAVNPAWRNGVLHAILIGPQPPNLTAQQARDEEEKIQQYMQT
WRDVTPGAGAYMNEGDPGEPDWKQAFYGSNYPRLLEIKRDWDPWGVFWAQTTVGSDAWEV
RTEDGYPRSQNGRLCRVGRRGEEENDDD

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	146	340	6.6e-37	0.40829694323144106

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	2.28e-17	148	291	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	1.08e-15	146	587	30	450	FAD/FMN-containing dehydrogenase [Energy production and conversion].
369658	BBE	2.29e-12	550	594	1	45	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD57322.1|GH43_11	1.77e-72	54	616	499	1065
QKD57322.1|CBM91|GH43_11	1.77e-72	54	616	499	1065
UJO16207.1|AA7	2.04e-14	148	587	128	545
UPK90596.1|AA7	9.75e-14	148	346	20	213
QBZ61916.1|AA7|CBM18	1.06e-13	148	588	275	711

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F72_A	4.36e-105	54	617	27	574	Crystal structure of VAO-type flavoprotein MtVAO615 at pH 7.5 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_A Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_B Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
6F74_A	5.04e-61	43	616	18	597	Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_B Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_C Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_D Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
6EO4_A	5.67e-19	148	587	48	462	Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens],6EO4_B Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens]
6EO5_A	1.01e-18	148	587	48	462	Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens],6EO5_B Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens]
6FYE_A	1.59e-16	148	315	45	203	The crystal structure of EncM H138T mutant [Streptomyces maritimus],6FYE_B The crystal structure of EncM H138T mutant [Streptomyces maritimus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2QDQ9|VAO15_MYCTT	2.24e-104	54	617	27	574	VAO-type flavoprotein oxidase VAO615 OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=MYCTH_2305637 PE=1 SV=1
sp|A0A1V6PBT1|CALF_PENDC	4.07e-97	50	617	22	575	Bifunctional decalin synthase calF OS=Penicillium decumbens OX=69771 GN=calF PE=1 SV=1
sp|A1CFM2|PATO_ASPCL	1.82e-93	51	617	25	568	FAD-linked oxidoreductase patO OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patO PE=1 SV=1
sp|A0A0E0RTV6|ZEB1_GIBZE	2.45e-91	51	616	23	562	FAD-linked oxidoreductase ZEB1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=ZEB1 PE=2 SV=2
sp|A0A0C6E5D0|BET5_NEOBT	1.75e-89	35	617	14	586	FAD-linked oxidoreductase orf1 OS=Neocamarosporium betae OX=1979465 GN=orf1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000366	0.999606	CS pos: 19-20. Pr: 0.9791

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS0352-t41_1-p1.