CAZyme Information: SAPIO_CDS0296-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS0296-t41_1-p1
• CAZy Family: AA1
• CAZyme Description: Choline dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
588	JOWA01000011|CGC5	63573.12	5.1679

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000011:1140914-1142814(+)

Full Sequence      

MKLLAIILGSTIVAAAMVKNSYDYVIVGGGTAGLALATRLSLGLPSAEILIIEAGSSALD
DIRINAPGMRGSALGSGYDWNFTTTPQENLGGRQIEVNRGHVLGGSSAINYLCYDRSAVA
EYNAWEELGNKGWNWDVMIEAMVKSENFTGSDVDLHGDSGPIRTTFNRKLPSCVESWKPT
MNAVGVETNERSLSGNPIGVSYQPTNIDTRRYTRSYVANSYLPLAGDNLEVLTNTQVAKV
DFAKKKCKGHLQAVGVTLDDGTKIKAKKEVILSAGSVQSPGLLENSGIGQPEVLKAAGIE
TLVDLPGVGENYQDHIRTSNTYRLKEGFDSFDPMIYDSGSDFVAEQVDLWLAGQPGWLDY
TTSTYAFLNWGQILNKTDEAALIAAAKTAAGKKPTTIDKKKIELLSDPTVPQIEIILEAN
YIGVKPYPGGSFITLFSSVMHPMARGSVHINPADPHGKPIIDPRYLSNEHDVQAIIVAAK
FSRKIANTAPMVDTWDKEFEPGEDVQSEEEWRAFARDATLSFYHPVGTCAMLPRKDGGVV
SERLVVHGTANLRVVDCSIIPTVMSAHIQTAAYGIAEIAAEMIIKDAK

Enzyme Prediction     

No EC number prediction in SAPIO_CDS0296-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	21	586	1.9e-173	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.07e-90	17	583	1	531	choline dehydrogenase; Validated
225186	BetA	5.88e-86	15	588	1	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	4.38e-63	23	583	2	486	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	2.04e-42	442	577	1	141	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	3.26e-24	91	315	15	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPC62655.1|AA3_2	2.44e-252	10	584	9	584
CEF86231.1|AA3_2	8.05e-251	10	584	9	584
CZS85570.1|AA3_2	8.05e-251	10	584	9	584
CEI41892.1|AA3_2	1.14e-250	10	586	9	586
QPC80030.1|AA3_2	3.77e-249	10	584	9	584

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	1.88e-82	17	588	1	569	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
4H7U_A	3.25e-69	22	585	41	599	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
5OC1_A	3.12e-64	22	586	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.19e-63	22	586	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6O9N_A	2.94e-63	16	586	30	641	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|M5EAX2|GMCH_MALS4	1.96e-98	20	584	45	616	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	1.96e-98	20	584	45	616	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|A0A142PTM2|CITC_MONPU	2.66e-78	10	586	2	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A161CEV4|CITC_MONRU	2.66e-78	10	586	2	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	5.45e-76	19	586	37	632	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.055443	0.944506	CS pos: 16-17. Pr: 0.6936

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS0296-t41_1-p1.