CAZyme Information: SAPIO_CDS0102-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS0102-t41_1-p1
• CAZy Family: AA1
• CAZyme Description: Oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
680		75053.56	4.2405

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000011:392955-395277(-)

Full Sequence      

MRTTALRIAAVLATLLSVVSGRPHELRGAKILQRADEVDEEYDYIIVGAGTAGLTVADRL
TADGKTTVLVIEYCHVISNEVTRAGGGRNFNDPGIRYNITSVKQPDMHNRTQAVRIGCCV
GGSSAINGMVAVRGTRSEYDGWAELGGPDSTWNWEGVIPYFRKAMHFTPPEEELAKTFNI
TWDPDAWGMEEDTHIYASFPTYQNPSIIPMYNAMTKMPNMDVPLDGANGNNGLFWFPSSL
DPKTYWRSYARTGHYDGIIDERDNLAVITRHKVRRILFDDDLAATGVEFFPRDSDAAEPE
EGEEEGEQEEKRPVSKTVKARKEVILSAGTVHTPQILQLSGIGPKDLLEEAGIEVLVDIP
GVGQNFQDHAYLSVGYRWANGAPPAPNVTVNGDPRTNSSPNLGAWVGLPTVTEDFEEIAA
RYEAQDPAEFLPPNSHPWVVDGYADFQKLHAKLLRSKNTNILWYPLSGGAGGIVMSMHVV
SHGTINIDPADPENEPIVDYRALSNPVDLDIMVENIRFLRRYMASEDFAEYEPEETMPGI
DVEGEELREWIREVLIPTNFHPIATAAKKPKEKGGVVDEELFVHDVKRLRVVDGSIMPLL
PGANTQQPVYMLAEKAVDLIKARNGGDAETEEPEAGEEGQEPVEEAPEAPEEEGTEEEPV
EEEAPVEEAPGDDEGSEHDE

Enzyme Prediction     

No EC number prediction in SAPIO_CDS0102-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	41	622	4.2e-150	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	8.56e-88	39	623	3	534	choline dehydrogenase; Validated
225186	BetA	1.63e-80	35	625	1	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.47e-28	481	616	3	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	2.38e-19	109	369	16	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	8.32e-14	264	612	234	568	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB80399.1|AA3_2	1.35e-158	26	621	23	628
CDP28753.1|AA3_2	1.13e-156	26	615	23	619
AEO63808.1|AA3_2	1.65e-156	7	621	3	635
VBB78527.1|AA3_2	2.15e-154	31	623	25	616
AEO58401.1|AA3_2	1.97e-152	31	623	36	634

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6O9N_A	1.10e-95	22	620	22	638	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
6ZE2_A	9.01e-94	38	621	2	583	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5OC1_A	8.26e-52	41	622	1	563	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	4.11e-51	41	622	2	564	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6XUT_A	1.17e-50	40	622	15	589	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	2.97e-89	27	625	23	618	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|M5EAX2|GMCH_MALS4	4.40e-74	40	620	45	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	4.40e-74	40	620	45	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|A0A2H3D1U1|ARMD5_ARMGA	1.06e-61	43	621	41	630	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	4.32e-59	42	624	41	611	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000649	0.999334	CS pos: 21-22. Pr: 0.9789

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS0102-t41_1-p1.