CAZyme Information: RhiirA1_538778-t46_1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: RhiirA1_538778-t46_1-p1
• CAZy Family: GT76
• CAZyme Description: FAD-binding domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
576		63405.07	5.6578

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisA1DAOM664342	26582	N/A	106	26476

• Gene Location: location=LLXH01000908:16768-18760(-)

Full Sequence      

MNFKKRFRFISLILYLTILVKTSIAVFVPGSYLTLPQCIAATEVSVIYPNYPGWRDAKIG
ERIRFQRRPVVVTYPINTTQVQWLVQCANSFKRMPVPRNGGHSNIGSSSMDNSVVIDISY
MDSLVIDAATQTATVGGGIRLGPLYIELDKAGFTIISATHPTVGLSGAIASGGFGLQSRK
YGVTGDWVLEAEVVTSDGSLLIANAGSHSDLFWALRGGGGGKYGIVTQWKLKLIPVWPKF
TVFNINYFYNGFEEVLTNFWNWAYGSIEDLSVSFVFTNNEFNIQGHFLGGEKDLHELVDK
TGLFKLSNAKAVKHDECTHLGSRAYFLDKDKTCDKIYLLNVGNSPFGPNYGDDPSLLTLQ
TAEITLVTEGVIEGYGAAPKQQREYVKTKSMFFAKELSVENITTIVERAKAMPPGAHAEL
TAYGGILGTQPTDLTAFPHRNGVAYHLLLEVSLTGNATIDEIALNFVNTWEEDLRPLSNG
RSYVGYEDEDLVNPGLSYFGGNLETLKNIDSIYDPNNILDSGQSQQQTELPLTNEKCPYI
VGGDPPGRRSSGVKINENNLNYITSILITFIILIAF

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	64	282	4.1e-71	0.4759825327510917

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223354	GlcD	4.37e-28	55	273	18	240	FAD/FMN-containing dehydrogenase [Energy production and conversion].
396238	FAD_binding_4	5.32e-28	69	204	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
273751	FAD_lactone_ox	7.33e-06	62	279	1	220	sugar 1,4-lactone oxidases. This model represents a family of at least two different sugar 1,4 lactone oxidases, both involved in synthesizing ascorbic acid or a derivative. These include L-gulonolactone oxidase (EC 1.1.3.8) from rat and D-arabinono-1,4-lactone oxidase (EC 1.1.3.37) from Saccharomyces cerevisiae. Members are proposed to have the cofactor FAD covalently bound at a site specified by Prosite motif PS00862; OX2_COVAL_FAD; 1.
215242	PLN02441	4.15e-05	64	214	60	220	cytokinin dehydrogenase
369658	BBE	6.62e-05	482	524	1	43	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGX49222.1|AA7|CBM1	1.50e-32	34	526	129	593
AHG26149.1|AA7	5.20e-31	33	546	4	489
QRW09115.1|AA7	2.03e-30	50	524	59	501
QLI74064.1|AA7	5.20e-30	37	524	31	488
CCA70426.1|AA7	1.44e-29	30	524	49	514

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EO4_A	4.12e-40	34	524	13	467	Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens],6EO4_B Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens]
6EO5_A	5.65e-40	34	524	13	467	Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens],6EO5_B Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens]
3VTE_A	2.46e-34	68	524	53	509	Crystal structure of tetrahydrocannabinolic acid synthase from Cannabis sativa [Cannabis sativa]
4DNS_A	6.51e-34	68	524	54	492	Crystal structure of Bermuda grass isoallergen BG60 provides insight into the various cross-allergenicity of the pollen group 4 allergens [Cynodon dactylon],4DNS_B Crystal structure of Bermuda grass isoallergen BG60 provides insight into the various cross-allergenicity of the pollen group 4 allergens [Cynodon dactylon]
4EC3_A	7.12e-33	68	524	51	496	Structure of berberine bridge enzyme, H174A variant in complex with (S)-reticuline [Eschscholzia californica]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A5ABH0|PYNB_ASPNC	2.83e-55	37	517	41	523	FAD-linked oxidoreductase pynB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pynB PE=1 SV=1
sp|Q0CZH0|PYTB_ASPTN	1.01e-49	46	503	41	499	FAD-linked oxidoreductase pytB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pytB PE=2 SV=1
sp|Q796Y5|YGAK_BACSU	2.28e-38	46	524	10	441	Uncharacterized FAD-linked oxidoreductase YgaK OS=Bacillus subtilis (strain 168) OX=224308 GN=ygaK PE=3 SV=4
sp|Q8GTB6|THCAS_CANSA	1.70e-33	68	524	80	536	Tetrahydrocannabinolic acid synthase OS=Cannabis sativa OX=3483 GN=THCAS PE=1 SV=1
sp|Q33DQ2|CBCAS_CANSA	3.12e-33	68	524	80	536	Cannabichromenic acid synthase OS=Cannabis sativa OX=3483 GN=CBCAS PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.721462	0.278535

TMHMM  Annotations     

Start	End
7	29