CAZyme Information: RhiirA1_521388-t46_1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: RhiirA1_521388-t46_1-p1
• CAZy Family: GT4
• CAZyme Description: UDP-Glycosyltransferase/glycogen phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
584		66814.37	8.5854

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisA1DAOM664342	26582	N/A	106	26476

• Gene Location: location=LLXH01000083:83769-88063(-)

Full Sequence      

MPTDGEVVDAIIGKLIVVAFGRPPHYPSKMGREFKQYAVPPADGWVPSEMILDRTEIPKN
ILLGVTIGGWNHLRHILTIANILADRGYNLTLAKRGKFLQSEQYPKINFISLGEEIDLSK
DPETIQLVKEKVDVGRFKKVFKNHYAAYDSIFLRLKEISEMIKPDLFFCDTVNNEPCFDV
AWLMKKPLVGISTSPLGLTHTPYRSDPIFGCKVNMENESFWERFRCEFISPLQFLWSFKS
SFDNFNKVRAGYGLPSLKSPFERWQNSLFLVDNFFGYETPVPLPPLYQEIGPVLPDYFPS
LTPDIEKFLNSHKRTMFVALGSFLFLSSENYAKLLQSIIEVIENNIVDGVIWANIEKYRE
SFPSNITLSDGRTISTSNLFDNKNSNIFMTSFAPQFSILNHTNTKIFLSHSGSGSVYESL
YAGTPLLSLPITYDQPGNAEKLELAGVALTLDKTNLEVKDILNKIEKILNDEQIRINTKR
LKTLAMINSKRKYRAADLIEFTLYSSVLKQKNINDENYNIEKWLFKELITPDTRMGLIRG
KYLDVYAAALIIVISITFLSIFIIRKLIYIKLFKVKEGDKDKKD

Enzyme Prediction     

No EC number prediction in RhiirA1_521388-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	222	485	6.3e-28	0.5602094240837696

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	5.52e-39	60	500	2	402	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	1.92e-23	63	500	5	396	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
278624	UDPGT	6.73e-17	267	484	227	421	UDP-glucoronosyl and UDP-glucosyl transferase.
273616	MGT	1.13e-16	363	500	254	387	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
223071	egt	3.80e-16	282	488	262	447	ecdysteroid UDP-glucosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOC55050.1|GT1	3.07e-57	56	539	35	529
QKD56593.1|GT1	3.68e-56	58	550	7	504
QPC75432.1|GT1	1.62e-53	56	550	7	507
QGI59140.1|GT1	5.85e-53	53	550	3	506
QGI90050.1|GT1	5.85e-53	53	550	3	506

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IPB_A	3.12e-14	385	481	90	186	Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_B Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_C Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_D Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens]
7CJX_A	4.56e-14	385	471	69	155	Chain A, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_B Chain B, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_C Chain C, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_D Chain D, UDP-glucuronosyltransferase 2B15 [Homo sapiens]
2O6L_A	4.28e-13	386	481	69	164	Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens],2O6L_B Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens]
6PNT_A	9.15e-09	363	481	299	411	Structural Characterization of UDP-glycosyltransferase from Tetranychus Urticae [Tetranychus urticae]
2IYF_A	1.43e-07	366	515	265	410	The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus],2IYF_B The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q64435|UD16_MOUSE	1.68e-16	71	484	37	444	UDP-glucuronosyltransferase 1-6 OS=Mus musculus OX=10090 GN=Ugt1a6 PE=1 SV=1
sp|Q3SY77|UD3A2_HUMAN	1.18e-15	61	473	25	432	UDP-glucuronosyltransferase 3A2 OS=Homo sapiens OX=9606 GN=UGT3A2 PE=2 SV=1
sp|P08430|UD16_RAT	6.56e-15	71	484	36	442	UDP-glucuronosyltransferase 1-6 OS=Rattus norvegicus OX=10116 GN=Ugt1a6 PE=1 SV=1
sp|P06133|UD2B4_HUMAN	8.68e-15	268	481	255	445	UDP-glucuronosyltransferase 2B4 OS=Homo sapiens OX=9606 GN=UGT2B4 PE=1 SV=2
sp|Q1LZI1|UD3A1_BOVIN	1.13e-14	62	473	25	432	UDP-glucuronosyltransferase 3A1 OS=Bos taurus OX=9913 GN=UGT3A1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999992	0.000062

TMHMM  Annotations     

Start	End
542	564