CAZyme Information: RhiirA1_516604-t46_1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: RhiirA1_516604-t46_1-p1
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
844	LLXH01000062|CGC1	95647.93	6.6130

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisA1DAOM664342	26582	N/A	106	26476

• Gene Location: location=LLXH01000062:88315-91924(+)

Full Sequence      

MSPPLSIHRVVVVSLFLPYTASFDIGKDKEYKYSRPVDINLTVPKPNLIEGLAAKRADGP
ASPIQQVEDPINKLFPSKVPTTPPQTLTSLTQPRSRAQNSGIDKKLSPSISSFTRKRRVS
IDSSNIFAEAPWTIEPCTQGNIGLQNAINSVAHNLTKRVWVGTLGMPTDTLTDKTRVDIR
AKLTTEYDSIPVIVPDHDFEGHYNQFCKQVLWPTFHYVLPDNPKKQIQEDEDTSWKHYVA
LNQHFADTITENYQPGDIIWINDYHLLLVPGMIRKKLPNAMIGFFLHIPFPSSEIFRCLP
VRKELLEGVLGADLIGFQTYSFARHFLQTCSRILSSILETTPKGIQLENNFVSVGIFPIG
IDIQALNDKRFHPEVLEWIEVLGEKYNGKKLVVARDKLDYVKGVRQKMLAFETFLTMHPE
WQGKVVLIQVALSTTEQNELQSQVSDVVARINSKFSNLAYQPVVYLHKDITFSQYLALLS
TADVCLITSLRDGMNLTSHEYVVCQETKHRPLILSEFAGTYGSFGAAIRINPWDYQECAN
AIHEALIISDEEATTKWKELYAYASLNSAQHWTENFVSELEKVHSDMQRRFSIHIPHLNP
RSFLGDFRNSQKRLFLLDYDGTLAAYEKAPNTNNSTKRLVDLLTRLTSDSRNVVYVMSGR
TSNSLEEQLGEVPNLGMSAENGSYLKLIGGKWENLFTDLDMSWKEQVNEIFEYYTERTPG
SLIEKKNLSIVWHYRTADNSNYGAWQAAECQNHIQDALGSTYPIHAIAGNKNIEVMARNI
SKSVAVRQILTTIEPDFILCMGDDRTDEDMFDFVNKLDNVKTVITCTVGSKSSEAKWFVS
GVLR

Enzyme Prediction     

EC	2.4.1.15:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	132	582	9.3e-169	0.9305263157894736

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340820	GT20_TPS	0.0	138	581	24	463	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
184712	PRK14501	0.0	143	842	29	713	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
395781	Glyco_transf_20	0.0	131	581	23	469	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
223457	OtsA	4.62e-177	160	584	64	481	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].
215556	PLN03064	1.81e-172	160	814	138	810	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMJ52388.1|GT20	0.0	1	844	1	830
CDS09009.1|GT20	3.78e-315	9	842	5	876
EGX50369.1|GT20	5.07e-243	12	835	5	892
UKZ66449.1|GT20	7.52e-238	126	843	152	896
UKZ92876.1|GT20	2.11e-237	126	835	149	881

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JBI_A	1.37e-123	143	583	29	465	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVM_A	3.32e-119	179	591	73	485	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HVO_A	6.97e-117	143	580	40	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HUV_A	2.64e-116	143	582	33	469	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]
5HUT_A	3.70e-116	143	582	33	469	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14081|TPSX_SCHPO	7.63e-173	69	821	132	903	Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 106 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC2E11.16c PE=1 SV=1
sp|Q9UUI7|TPSY_SCHPO	1.39e-168	91	842	113	879	Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 100 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC22F8.05 PE=1 SV=1
sp|Q54K57|TPSA_DICDI	4.84e-164	137	840	39	722	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1
sp|Q54NU9|TPSB_DICDI	1.10e-158	192	839	128	774	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum OX=44689 GN=tpsB PE=3 SV=1
sp|P38426|TPS3_YEAST	6.17e-157	116	766	296	929	Trehalose synthase complex regulatory subunit TPS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS3 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000367	0.999625	CS pos: 22-23. Pr: 0.9723

TMHMM  Annotations     

There is no transmembrane helices in RhiirA1_516604-t46_1-p1.