CAZyme Information: RhiirA1_513807-t46_1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: RhiirA1_513807-t46_1-p1
• CAZy Family: GT34
• CAZyme Description: UDP-Glycosyltransferase/glycogen phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
293		33037.04	8.3682

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisA1DAOM664342	26582	N/A	106	26476

• Gene Location: location=LLXH01000515:2611-4162(-)

Full Sequence      

MSIEPVYMSFRRLLRTSLVFIDTFFGLELPQALPSNVQEIGPIISKDYPPLTPELSNFMN
VHERVLYIAFGGRFFTTTENNNKILQSIIEIINKNMIDGVIWALVMTSKNDFSPTLNLSN
GLQVQTSSILNNEHPHIHITNFAPQFAVLNHTNTKLFFSHGGAGSIHESLFTGTPMLVLP
IGGDQMGNAQKLKSAGVALSLNKFTLDVNDIITKINFLLNDNDVKKNVDRMKVLAKINSK
RKYRAADLIEYILHRGSSNQELKELIPADKRMGFIRGNNYDVYITLLENYGYD

Enzyme Prediction     

No EC number prediction in RhiirA1_513807-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	47	233	2.4e-25	0.3900523560209424

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	2.60e-32	2	252	177	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
223071	egt	4.01e-20	34	263	264	475	ecdysteroid UDP-glucosyltransferase; Provisional
278624	UDPGT	2.75e-19	21	287	231	471	UDP-glucoronosyl and UDP-glucosyl transferase.
224732	YjiC	4.89e-15	139	250	288	396	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
340818	GT28_MurG	2.96e-08	34	249	151	347	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPC75432.1|GT1	1.60e-51	18	287	228	507
QKD47039.1|GT1	5.98e-51	18	287	227	506
QKX59607.1|GT1	2.38e-50	18	286	227	508
BCR88254.1|GT1	3.81e-50	18	283	229	505
QKD56593.1|GT1	5.23e-50	18	291	225	508

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IPB_A	2.96e-12	41	231	19	186	Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_B Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_C Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_D Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens]
7CJX_A	4.86e-12	144	228	78	162	Chain A, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_B Chain B, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_C Chain C, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_D Chain D, UDP-glucuronosyltransferase 2B15 [Homo sapiens]
2O6L_A	4.32e-10	144	231	77	164	Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens],2O6L_B Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens]
6J31_A	1.39e-09	135	250	279	391	Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]
6J32_A	1.40e-09	135	250	282	394	Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36513|UDB14_RABIT	1.71e-16	21	259	259	476	UDP-glucuronosyltransferase 2B14 OS=Oryctolagus cuniculus OX=9986 GN=UGT2B14 PE=2 SV=1
sp|Q6UWM9|UD2A3_HUMAN	3.10e-16	21	259	256	473	UDP-glucuronosyltransferase 2A3 OS=Homo sapiens OX=9606 GN=UGT2A3 PE=2 SV=2
sp|P36512|UDB13_RABIT	4.21e-16	21	259	260	477	UDP-glucuronosyltransferase 2B13 OS=Oryctolagus cuniculus OX=9986 GN=UGT2B13 PE=2 SV=1
sp|A0A291PQH4|UGT2_DACCO	5.54e-16	16	257	237	457	UDP-glucosyltransferase 2 OS=Dactylopius coccus OX=765876 GN=UTG2 PE=1 SV=1
sp|Q5RFJ3|UD2A3_PONAB	2.51e-15	21	287	256	496	UDP-glucuronosyltransferase 2A3 OS=Pongo abelii OX=9601 GN=UGT2A3 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.997671	0.002321

TMHMM  Annotations     

There is no transmembrane helices in RhiirA1_513807-t46_1-p1.