CAZyme Information: RhiirA1_493551-t46_1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: RhiirA1_493551-t46_1-p1
• CAZy Family: GT22
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
969		111100.79	6.0311

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisA1DAOM664342	26582	N/A	106	26476

• Gene Location: location=LLXH01000138:201464-205157(-)

Full Sequence      

MCLGIIGKNSNRFTVQFFLFICFIVMATNVVVSMKPQDFRTCAQTSFCRRNRAYADKATS
SSFISPYNVVKDTINIENGIISGELINTDNKVSFIFEIHLLINNIARIKINEKYPLKPRY
DGAKYWSLIQEPLNTLEYTENPSTGKDGVTSLSFGVDRNHKVIIHHTPFHVELLVNDEPV
IIFNNRGFFNFEHLRKKDDPANQPEELTIQSEINAEQEEGLWEETFNGKLDSKPNGPESI
GLDISFPGFSHVYGIPEHASTLSLKETRGGDGAYNEPYRLYNLDVFEFDLDSPAALYGSI
PFLLAHRKGASTAILWLNAAETWIDIVKSKDDKGFLSFGKSTPTSTHTHWFSESGIIDVF
AFLGPTTSDIFKQYGLLTGFTALPQSFAIGYHQCRWNYLNQDDVAEVDEGFDKYDIPYDV
IWLDIEHTDDKRYFTWDKVKFSEPEKMQRDIGRKGRNMVVIVDPHVKRDDNYYIYKEAKD
LDILTKDKDGKIFEGWCWPGSSVWIDWTNPKAQEWFAKKFAFDQYKGSTEFLFIWNDMNE
PSIFSGPEITMPKDLLHYEGWEHRDLHNLFGMTFHAATSQGLINRTSPNHRPFVLSRSFF
PGSQRFGAIWTGDIAANWDHLAASSPMLLTIGISGLPFSGADVGGFFGNPEPELLVRWYQ
TGAFQPFFRAHAHIDTKRREPWLFGEPYTGYIRNAIRQRYILLPFWYTLFQEASTNGMPI
IRPMFVVFPDNEETFAMEDQYFVGNSLLVKPITSQGQTTTEIYFAGNDLYYDYYTFKKVQ
GSGKLKMDILMNKIPVFLRGGSIIPRRQRFRRSSSAMYSDPFTLLVALNKKGEAAGTLYL
DDGKTYEYLKGHYIHRNFNFTSGKFISTSFNNEQVQDNENNYIKSNDDVRIERIIVLGVD
KSPKKIIGYYNDLIDDKKELKFSLGGINDIKGIVSTSIGIGVEEISKDIIIIRDPKLLIS
RDWTIEFVN

Enzyme Prediction     

EC	3.2.1.20:27	3.2.1.84:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	360	804	7.1e-156	0.9953161592505855

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269889	GH31_GANC_GANAB_alpha	0.0	379	845	1	467	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
395838	Glyco_hydro_31	0.0	360	804	1	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
224418	YicI	1.50e-178	160	902	83	761	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
269890	GH31_glucosidase_II_MalA	6.89e-148	379	717	1	339	Alpha-glucosidase II-like. Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities. Alpha-glucosidase II has been characterized in Bacillus thermoamyloliquefaciens where it forms a homohexamer. This subgroup also includes the MalA alpha-glucosidase from Sulfolobus solfataricus and the AglA alpha-glucosidase from Picrophilus torridus. MalA is part of the carbohydrate-metabolizing machinery that allows this organism to utilize carbohydrates, such as maltose, as the sole carbon and energy source.
215408	PLN02763	2.12e-113	365	854	164	644	hydrolase, hydrolyzing O-glycosyl compounds

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS08390.1|GH31	0.0	34	966	27	943
KAF2113743.1|GH31	0.0	8	967	5	988
EGX52673.1|GH31	0.0	33	965	30	965
QRD05297.1|GH31	0.0	33	967	31	984
KAF2279870.1|GH31	0.0	32	967	31	983

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DKX_A	2.86e-305	34	898	5	896	Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495],5DKY_A Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495],5JQP_A Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495]
5DKZ_A	4.62e-304	34	898	5	896	Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495],5DL0_A Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495]
5IEF_A	8.29e-287	38	901	5	867	Murine endoplasmic reticulum alpha-glucosidase II with N-butyl-1-deoxynojirimycin [Mus musculus]
5IEG_A	8.58e-287	38	901	5	867	Murine endoplasmic reticulum alpha-glucosidase II with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]
7KRY_A	1.93e-285	38	901	36	898	Chain A, Neutral alpha-glucosidase AB [Mus musculus],7KRY_C Chain C, Neutral alpha-glucosidase AB [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9FN05|PSL5_ARATH	5.86e-291	21	968	11	921	Probable glucan 1,3-alpha-glucosidase OS=Arabidopsis thaliana OX=3702 GN=PSL5 PE=1 SV=1
sp|Q8BHN3|GANAB_MOUSE	3.02e-286	30	901	29	899	Neutral alpha-glucosidase AB OS=Mus musculus OX=10090 GN=Ganab PE=1 SV=1
sp|P79403|GANAB_PIG	2.75e-284	30	901	29	899	Neutral alpha-glucosidase AB OS=Sus scrofa OX=9823 GN=GANAB PE=1 SV=1
sp|Q14697|GANAB_HUMAN	4.43e-283	19	901	18	899	Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3
sp|B9F676|GLU2A_ORYSJ	5.44e-283	35	965	30	916	Probable glucan 1,3-alpha-glucosidase OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0216600 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.128532	0.871436	CS pos: 33-34. Pr: 0.8157

TMHMM  Annotations     

Start	End
13	32