CAZyme Information: RhiirA1_49173-t46_1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: RhiirA1_49173-t46_1-p1
• CAZy Family: GT20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365	LLXH01001423|CGC1	42644.86	8.5645

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisA1DAOM664342	26582	N/A	106	26476

• Gene Location: location=LLXH01001423:19506-20818(+)

Full Sequence      

MTNKHRFSKIHAYSPHTLVDSIHPYYIRAESKFKPDDVTVITFVTHNRLNELVRLAELWK
GPISATLHIPSKIGLTDPLIVETINSIKKIYKKKTNLRKQIDIHLITGPSTSLNETLLPT
PTNFHVNVARFFARTEFIFFLDFDTWPTPETHSNIKRYADILIKNNVLILPTFVFIENVE
HVENSTIHYKFPKTKNDVIRLVNRRKLGLQDYGWEINSGPTCLDSWLKADELFHVEEYEL
HYRPNFVARKGGQIPWCSERFDDNKAACIFEIYLSGAELYVDPNSFLIRHHFDQDSHLVN
YGDPHWQKVINSRMYTNFSREVCLLYVRTFVAMDLWKSPISDHVKQECQRVLASWGSGLI
KNSEK

Enzyme Prediction     

No EC number prediction in RhiirA1_49173-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT49	30	327	1.2e-26	0.8367952522255193

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404735	Glyco_transf_49	6.18e-21	37	326	1	326	Glycosyl-transferase for dystroglycan. This glycosyl-transferase brings about the glycosylation of the alpha-dystroglycan subunit. Dystroglycan is an integral member of the skeletal muscular dystrophin glycoprotein complex, which links dystrophin to proteins in the extracellular matrix.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS11928.1|GT49	1.26e-63	1	364	162	510
CDS07474.1|GT49	1.07e-60	1	364	178	525
CDS14416.1|GT49	1.33e-58	19	354	150	484
CDS06217.1|GT49	2.04e-56	24	351	113	424
CDS06289.1|GT49	2.43e-55	24	351	103	414

PDB Hits     

RhiirA1_49173-t46_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q21389|LGE1_CAEEL	1.38e-14	34	312	349	613	Glycosyltransferase-like protein LARGE OS=Caenorhabditis elegans OX=6239 GN=lge-1 PE=3 SV=3
sp|Q54PG8|GNT14_DICDI	1.07e-10	38	343	348	633	Glycosyltransferase-like protein gnt14 OS=Dictyostelium discoideum OX=44689 GN=gnt14 PE=2 SV=1
sp|Q32NJ7|LRG2B_XENLA	1.52e-10	35	289	438	672	Xylosyl- and glucuronyltransferase LARGE2s OS=Xenopus laevis OX=8355 GN=large2-b PE=2 SV=1
sp|Q66PG1|LARG2_DANRE	2.05e-10	18	289	446	699	Xylosyl- and glucuronyltransferase LARGE2s OS=Danio rerio OX=7955 GN=large2 PE=2 SV=1
sp|Q66PG4|LARG2_CHICK	2.66e-09	35	289	454	688	Xylosyl- and glucuronyltransferase LARGE2s OS=Gallus gallus OX=9031 GN=LARGE2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000000

TMHMM  Annotations     

There is no transmembrane helices in RhiirA1_49173-t46_1-p1.