CAZyme Information: RhiirA1_480344-t46_1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: RhiirA1_480344-t46_1-p1
• CAZy Family: GT2
• CAZyme Description: D-lactate dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
391		42723.32	4.7216

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisA1DAOM664342	26582	N/A	106	26476

• Gene Location: location=LLXH01004903:15-1187(-)

Full Sequence      

MSYIVSTVVEELLTVLKEDQVTTNETVRELHAKDESHHKPILPDVVVFPRSTEDVQAIVK
LASQHLIPIVPFGAGSSLEGNSIPVHKGISIDFSQMNEILEISPEDLLVKVQPGVTRLQL
NKELKKHGLQFTVDPGADASIGGMVATNASGTTAVHYGVMRDQVRDLEVVLADGSVIHTG
NLAVKSSSGYHLNGLFVGSEGTLGCFTEITIQVYGIPEFVTAGRAVFETVDAAIDAVTVL
RQAGIQIGRVELVDAFSVRQANIYKETNYEEKPTIFLEFHGNQSGMEEDVAYTKEIFEEF
GCLSISFETDTASRNKLWEVRHHIAYAYTHGYPGRKMMTTDVCVPISKLAAAIRFARTQI
EETGLEGGVIGHVGDGNFHAMVMFDTNSEDE

Enzyme Prediction     

No EC number prediction in RhiirA1_480344-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA4	7	244	2.2e-29	0.48084291187739464

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178402	PLN02805	3.43e-109	8	391	98	482	D-lactate dehydrogenase [cytochrome]
223354	GlcD	1.51e-93	11	391	1	389	FAD/FMN-containing dehydrogenase [Energy production and conversion].
183043	PRK11230	7.09e-55	42	391	55	405	glycolate oxidase subunit GlcD; Provisional
396238	FAD_binding_4	1.59e-50	43	180	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
397178	FAD-oxidase_C	2.78e-32	216	391	1	182	FAD linked oxidases, C-terminal domain. This domain has a ferredoxin-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSZ31245.1|GT31	4.35e-72	42	385	547	876
QGA13141.1|AA4	7.05e-15	29	245	74	300
BCS27721.1|AA4	2.25e-14	29	245	74	300
CDR36620.1|AA4	4.15e-13	45	200	96	266
AEO67281.1|AA4	7.45e-13	46	217	113	296

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PM9_A	1.67e-31	38	382	51	398	Chain A, Putative oxidoreductase [Rhodopseudomonas palustris],3PM9_B Chain B, Putative oxidoreductase [Rhodopseudomonas palustris],3PM9_C Chain C, Putative oxidoreductase [Rhodopseudomonas palustris],3PM9_D Chain D, Putative oxidoreductase [Rhodopseudomonas palustris],3PM9_E Chain E, Putative oxidoreductase [Rhodopseudomonas palustris],3PM9_F Chain F, Putative oxidoreductase [Rhodopseudomonas palustris]
6LPN_A	6.14e-28	45	388	56	404	Chain A, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPN_B Chain B, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPP_A Chain A, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPP_B Chain B, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPQ_A Chain A, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPQ_B Chain B, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPT_A Chain A, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPT_B Chain B, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPU_A Chain A, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPU_B Chain B, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPX_A Chain A, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPX_B Chain B, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens]
2UUU_A	6.65e-25	43	243	138	341	alkyldihydroxyacetonephosphate synthase in P212121 [Dictyostelium discoideum],2UUU_B alkyldihydroxyacetonephosphate synthase in P212121 [Dictyostelium discoideum],2UUU_C alkyldihydroxyacetonephosphate synthase in P212121 [Dictyostelium discoideum],2UUU_D alkyldihydroxyacetonephosphate synthase in P212121 [Dictyostelium discoideum],2UUV_A alkyldihydroxyacetonephosphate synthase in P1 [Dictyostelium discoideum],2UUV_B alkyldihydroxyacetonephosphate synthase in P1 [Dictyostelium discoideum],2UUV_C alkyldihydroxyacetonephosphate synthase in P1 [Dictyostelium discoideum],2UUV_D alkyldihydroxyacetonephosphate synthase in P1 [Dictyostelium discoideum]
4BC7_A	6.27e-24	42	227	205	395	MAMMALIAN ALKYLDIHYDROXYACETONEPHOSPHATE SYNTHASE: Arg419His mutant [Cavia porcellus],4BC7_B MAMMALIAN ALKYLDIHYDROXYACETONEPHOSPHATE SYNTHASE: Arg419His mutant [Cavia porcellus],4BC7_C MAMMALIAN ALKYLDIHYDROXYACETONEPHOSPHATE SYNTHASE: Arg419His mutant [Cavia porcellus],4BC7_D MAMMALIAN ALKYLDIHYDROXYACETONEPHOSPHATE SYNTHASE: Arg419His mutant [Cavia porcellus]
4BBY_A	6.27e-24	42	227	205	395	Mammalian Alkyldihydroxyacetonephosphate Synthase: Wild-Type [Cavia porcellus],4BBY_B Mammalian Alkyldihydroxyacetonephosphate Synthase: Wild-Type [Cavia porcellus],4BBY_C Mammalian Alkyldihydroxyacetonephosphate Synthase: Wild-Type [Cavia porcellus],4BBY_D Mammalian Alkyldihydroxyacetonephosphate Synthase: Wild-Type [Cavia porcellus],4BC9_A MAMMALIAN ALKYLDIHYDROXYACETONEPHOSPHATE SYNTHASE: WILD-TYPE, ADDUCT WITH CYANOETHYL [Cavia porcellus],4BC9_B MAMMALIAN ALKYLDIHYDROXYACETONEPHOSPHATE SYNTHASE: WILD-TYPE, ADDUCT WITH CYANOETHYL [Cavia porcellus],4BC9_C MAMMALIAN ALKYLDIHYDROXYACETONEPHOSPHATE SYNTHASE: WILD-TYPE, ADDUCT WITH CYANOETHYL [Cavia porcellus],4BC9_D MAMMALIAN ALKYLDIHYDROXYACETONEPHOSPHATE SYNTHASE: WILD-TYPE, ADDUCT WITH CYANOETHYL [Cavia porcellus],5ADZ_A Ether Lipid-Generating Enzyme AGPS in complex with inhibitor 1a [Cavia porcellus],5ADZ_B Ether Lipid-Generating Enzyme AGPS in complex with inhibitor 1a [Cavia porcellus],5ADZ_C Ether Lipid-Generating Enzyme AGPS in complex with inhibitor 1a [Cavia porcellus],5ADZ_D Ether Lipid-Generating Enzyme AGPS in complex with inhibitor 1a [Cavia porcellus],5AE1_A Ether Lipid-Generating Enzyme AGPS in complex with inhibitor ZINC69435460 [Cavia porcellus],5AE1_B Ether Lipid-Generating Enzyme AGPS in complex with inhibitor ZINC69435460 [Cavia porcellus],5AE1_C Ether Lipid-Generating Enzyme AGPS in complex with inhibitor ZINC69435460 [Cavia porcellus],5AE1_D Ether Lipid-Generating Enzyme AGPS in complex with inhibitor ZINC69435460 [Cavia porcellus],5AE2_A Ether Lipid-Generating Enzyme AGPS in complex with inhibitor 1e [Cavia porcellus],5AE2_B Ether Lipid-Generating Enzyme AGPS in complex with inhibitor 1e [Cavia porcellus],5AE2_C Ether Lipid-Generating Enzyme AGPS in complex with inhibitor 1e [Cavia porcellus],5AE2_D Ether Lipid-Generating Enzyme AGPS in complex with inhibitor 1e [Cavia porcellus],5AE3_A Ether Lipid-Generating Enzyme AGPS in complex with antimycin A [Cavia porcellus],5AE3_B Ether Lipid-Generating Enzyme AGPS in complex with antimycin A [Cavia porcellus],5AE3_C Ether Lipid-Generating Enzyme AGPS in complex with antimycin A [Cavia porcellus],5AE3_D Ether Lipid-Generating Enzyme AGPS in complex with antimycin A [Cavia porcellus],6GOU_A Development of Alkyl Glycerone Phosphate Synthase Inhibitors: Complex with Inhibitor 2I [Cavia porcellus],6GOU_B Development of Alkyl Glycerone Phosphate Synthase Inhibitors: Complex with Inhibitor 2I [Cavia porcellus],6GOU_C Development of Alkyl Glycerone Phosphate Synthase Inhibitors: Complex with Inhibitor 2I [Cavia porcellus],6GOU_D Development of Alkyl Glycerone Phosphate Synthase Inhibitors: Complex with Inhibitor 2I [Cavia porcellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|F1QXM5|LDHD_DANRE	1.79e-109	5	391	32	421	Probable D-lactate dehydrogenase, mitochondrial OS=Danio rerio OX=7955 GN=ldhd PE=2 SV=1
sp|Q7TNG8|LDHD_MOUSE	3.96e-102	9	391	32	417	Probable D-lactate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Ldhd PE=1 SV=1
sp|Q86WU2|LDHD_HUMAN	3.07e-101	9	391	32	440	Probable D-lactate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=LDHD PE=1 SV=1
sp|Q94AX4|DLD_ARATH	1.47e-91	9	391	111	494	D-lactate dehydrogenase [cytochrome], mitochondrial OS=Arabidopsis thaliana OX=3702 GN=DLD PE=1 SV=1
sp|Q12627|DLD1_KLULA	1.09e-73	11	386	116	498	D-lactate dehydrogenase [cytochrome], mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=DLD1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000000

TMHMM  Annotations     

There is no transmembrane helices in RhiirA1_480344-t46_1-p1.