CAZyme Information: RhiirA1_479413-t46_1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: RhiirA1_479413-t46_1-p1
• CAZy Family: GT2
• CAZyme Description: glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
266		31234.92	6.7208

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisA1DAOM664342	26582	N/A	106	26476

• Gene Location: location=LLXH01004294:673-1473(+)

Full Sequence      

MPKVVDTLTTLDKILNEKCSLARYGDGELLIMCNKNVNFQNYDFELATRLREILSTETDN
LMLGIPNVFVTLDNFENKDKDYWIRNLAMNRRMWSKVTKSNIKYYDAFFSRPYIIYKNKS
NSVKYFKMIKLIWNNRNIIIVEGEKSRLGVGNDLFDNAKSIKRIICPSENAYVKYNDILN
TVSKQNHEDLILIALGPTATILTFDLHQLGYQAIDIGHLDIEYEWFLRNVQEKVKIEGKY
VNEVEDGRNVEELEDKYYINQIIKVI

Enzyme Prediction     

No EC number prediction in RhiirA1_479413-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT101	22	243	4.3e-89	0.9910714285714286

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
163440	glyco_access_1	5.30e-112	4	263	1	261	glycosyltransferase, SP_1767 family. Members of this protein family are putative glycosyltransferases. Some members are found close to genes for the accessory secretory (SecA2) system, and are suggested by Partial Phylogenetic Profiling to correlate with SecA2 systems. Glycosylation, therefore, may occur in the cytosol prior to secretion.
400898	GT-D	5.35e-111	22	244	1	223	Glycosyltransferase GT-D fold. This domain is found at the C-terminus of proteins such as the probable glycosyltransferase Gly that also contain the glycosyl transferase domain at the N-terminus. It is also found N-terminal in numerous putative glycosyltransferases such as GalT1. GalT1 has been shown to catalyze the third step of Fap1 glycosylation. This domain is structurally distinct from all known GT folds of glycosyltransferases and contains a metal binding site. This new glycosyltransferase fold has been named GT-D.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWH94876.1|GT101	5.71e-90	2	266	43	307
QQA15849.1|GT101	6.55e-89	2	266	43	307
QWI40596.1|GT101	6.55e-89	2	266	43	307
AJH18501.1|GT101	6.55e-89	2	266	43	307
QUG86578.1|GT101	6.55e-89	2	266	43	307

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5V4A_A	4.70e-66	10	263	14	268	A New Glycosyltransferase (DUF1792) from Streptococcus sanguinis [Streptococcus sanguinis SK36],5V4A_B A New Glycosyltransferase (DUF1792) from Streptococcus sanguinis [Streptococcus sanguinis SK36]
4PFX_A	1.69e-61	3	263	13	273	The highly conserved domain of unknown function 1792 has a distinct glycosyltransferase fold [Streptococcus parasanguinis FW213]
4PHR_A	1.69e-61	3	263	13	273	Domain of unknown function 1792 (DUF1792) with manganese [Streptococcus parasanguinis FW213]
4PHS_A	3.82e-60	3	263	13	273	Selenomethionine substituted structure of domain of unknown function 1792 (DUF1792) [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9AEU2|GLY_STRGN	1.39e-59	10	263	423	676	Probable glycosyl transferase Gly OS=Streptococcus gordonii OX=1302 GN=gly PE=3 SV=2
sp|A0A0H2URB1|GLYD_STRPN	2.13e-55	10	263	556	809	Glycosyltransferase GlyD OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000000

TMHMM  Annotations     

There is no transmembrane helices in RhiirA1_479413-t46_1-p1.