CAZyme Information: RhiirA1_439045-t46_1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: RhiirA1_439045-t46_1-p1
• CAZy Family: GT15
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
485		56177.65	6.2005

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisA1DAOM664342	26582	N/A	106	26476

• Gene Location: location=LLXH01000181:74065-75672(-)

Full Sequence      

MEQVDKRMLMREELFGITDNLIPCMKQDTTEIFYRFLANKSKKIDMSILHSYTAEKMEFN
DIIEIDIQHSDDLHHYLLENAKSLQEECTTFDHLVIIDTFTMINLEKIKNKISTSTLVTD
TQKLVWGSFNSNRTENMAVIIGASAIQPILDNLKFKLNHTSILSSLYLYHKKYPNKKIPS
DLIFINDPISIIEWPNTITSIECADCVVAIGHIYQDVEIKQIKNELNIPTTLPCNARSDL
KMYSKETASKFRPNVAVVTSSFLYKDNCMLEAGFLSAKNKREYAEMHGYAFVSRSAEFAQ
QLYHDRKPVWGKIDAIEKLLPYYEWLIWLDMDAIFVNRSLTVERFLEMCEEKVGGKEEFE
KINIIVARPINDKMINAGVFLIKNSAWTRDLLRRGIQPRYDFSYTGSLEQEAMRDAIRHP
YWRKNVLNLEYDDHSLNTFPDRYVRGDFIVHYAPIGGCPAAPVLRGLSNVKVLEEFPNAE
ISIPF

Enzyme Prediction     

No EC number prediction in RhiirA1_439045-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	276	453	2.1e-20	0.8455284552845529

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	1.58e-20	253	458	3	232	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.
215617	PLN03182	2.85e-09	252	392	126	262	xyloglucan 6-xylosyltransferase; Provisional
215616	PLN03181	1.81e-07	278	392	155	263	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS05704.1|GT34	5.34e-81	2	475	153	685
CDS09137.1|GT34	4.92e-80	2	474	133	646
CAG4711197.1|GT34	5.70e-20	250	459	7	206
BBN05257.1|GT34	7.83e-16	275	453	136	330
ACO66271.1|GT34	1.28e-12	276	476	215	417

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BSU_A	4.49e-06	276	392	59	169	Chain A, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSU_B Chain B, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSV_A Chain A, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSV_B Chain B, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSW_A Chain A, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSW_B Chain B, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94622|YBKD_SCHPO	7.02e-12	278	458	129	333	Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1289.13c PE=3 SV=1
sp|Q09174|GMA12_SCHPO	1.25e-10	278	458	129	333	Alpha-1,2-galactosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gma12 PE=1 SV=1
sp|P50108|MNN10_YEAST	4.26e-10	275	440	148	333	Probable alpha-1,6-mannosyltransferase MNN10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN10 PE=1 SV=1
sp|P78817|YFE6_SCHPO	1.43e-08	275	392	101	238	Uncharacterized alpha-1,2-galactosyltransferase C637.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC637.06 PE=2 SV=2
sp|Q9SZG1|GT6_ARATH	5.39e-06	278	417	133	269	Glycosyltransferase 6 OS=Arabidopsis thaliana OX=3702 GN=GT6 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000000

TMHMM  Annotations     

There is no transmembrane helices in RhiirA1_439045-t46_1-p1.