CAZyme Information: RhiirA1_417417-t46_1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: RhiirA1_417417-t46_1-p1
• CAZy Family: GH47
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
593		67115.71	6.7787

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisA1DAOM664342	26582	N/A	106	26476

• Gene Location: location=LLXH01000358:28080-30810(+)

Full Sequence      

MGNIKRIFALIITLFVISAFSRSTFSEQLKHKRQNKDNGLFTPYIPLEPTPNPITRSYEV
ELSQINLAPDGFTKTIFAINGQYPGTVIHANKGDRIQVTVKNNIGEPSVIHWHGMFQRGT
NWYDGVSGQTQCPIPNGSSFVYDFSTQEQRGTFWYHAHTHGQYMEGIRAPLIIHDPNDPY
RKDYDFEYIITMSDWYHQRVSDMLAIRMSPNYGGRNPIPDSGLISGAGRYNCSAAPPGSE
CRENNPLAEYKVTPGKKYRLRLINTSGLSHFMFSIDNHPLKIIEADGEYSKPVIVNKLPV
AIGQRYSVIIDANQKVDNYWMRATIDDRCLLINNQTVNFDSAINYNVTGILKYDGAGLGY
PTSTEYPDQLEPCLSIDPNLLKTLEPQQIPGPATNKIQLVVTFRDDDQNVTRAFINNSSF
VVDDNNPTLEKFVSDDVPLDQFPANQNIYAYDQLGGTIDIAYINNNSAIHPIHMHGHNFY
VLGTGSGIVVDESKLNLVDPFPRDTFVVNSTSWSVFRYKADNPGVWSIHCHIEWHVEMGM
IAQLIELPTELSKVTIPESVSNLCKQQDNSNSKRSKFSRRNRLFNTDMKRIKV

Enzyme Prediction     

No EC number prediction in RhiirA1_417417-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA1	72	540	6.1e-119	0.9776536312849162

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274555	ascorbase	1.03e-97	55	550	1	534	L-ascorbate oxidase, plant type. Members of this protein family are the copper-containing enzyme L-ascorbate oxidase (EC 1.10.3.3), also called ascorbase. This family is found in flowering plants, and shows greater sequence similarity to a family of laccases (EC 1.10.3.2) from plants than to other known ascorbate oxidases.
215324	PLN02604	3.78e-87	55	540	24	540	oxidoreductase
177843	PLN02191	2.17e-81	50	554	18	554	L-ascorbate oxidase
274556	laccase	2.56e-72	73	540	21	513	laccase, plant. Members of this protein family include the copper-containing enzyme laccase (EC 1.10.3.2), often several from a single plant species, and additional, uncharacterized, closely related plant proteins termed laccase-like multicopper oxidases. This protein family shows considerable sequence similarity to the L-ascorbate oxidase (EC 1.10.3.3) family. Laccases are enzymes of rather broad specificity, and classification of all proteins scoring about the trusted cutoff of this model as laccases may be appropriate.
225043	SufI	1.53e-71	70	548	48	450	Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) [Cell cycle control, cell division, chromosome partitioning, Inorganic ion transport and metabolism, Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO70365.1|AA1	6.24e-109	53	564	109	658
QRV98945.1|AA1	2.19e-108	53	566	65	593
QRW13493.1|AA1	6.09e-108	53	566	65	593
AUS45844.1|AA1	6.27e-108	55	566	122	657
QKX53525.1|AA1	1.95e-105	53	527	104	591

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EHF_A	7.44e-94	59	568	7	490	Laccase from Antrodiella faginea [Antrodiella faginea]
3KW7_A	3.35e-93	59	568	7	495	Crystal structure of LacB from Trametes sp. AH28-2 [Trametes sp. AH28-2],3KW7_B Crystal structure of LacB from Trametes sp. AH28-2 [Trametes sp. AH28-2]
5NQ7_A	7.36e-93	59	564	28	507	Crystal structure of laccases from Pycnoporus sanguineus, izoform I [Trametes sanguinea]
4JHU_A	2.19e-92	59	564	7	485	T2-depleted laccase from Coriolopsis caperata soaked with CuCl [Coriolopsis caperata],4JHV_A T2-depleted laccase from Coriolopsis caperata [Coriolopsis caperata]
5ANH_A	8.55e-92	59	568	7	489	Crystal Structure Of Laccase From Basidiomycete Pm1 (cect 2971) [basidiomycete PM1],5ANH_B Crystal Structure Of Laccase From Basidiomycete Pm1 (cect 2971) [basidiomycete PM1],5ANH_C Crystal Structure Of Laccase From Basidiomycete Pm1 (cect 2971) [basidiomycete PM1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12719|LAC4_TRAVE	1.86e-93	59	564	29	509	Laccase-4 OS=Trametes versicolor OX=5325 GN=LCC4 PE=3 SV=1
sp|Q99055|LAC4_TRAVI	5.18e-93	59	564	29	509	Laccase-4 OS=Trametes villosa OX=47662 GN=LCC4 PE=3 SV=1
sp|Q02081|LAC4_THACU	2.74e-92	56	555	23	505	Laccase-4 OS=Thanatephorus cucumeris OX=107832 GN=LCC4 PE=1 SV=1
sp|O59896|LAC1_PYCCI	2.92e-91	59	564	28	507	Laccase OS=Pycnoporus cinnabarinus OX=5643 GN=LCC3-1 PE=1 SV=1
sp|Q12541|LAC1_AGABI	6.09e-91	55	559	21	498	Laccase-1 OS=Agaricus bisporus OX=5341 GN=lcc1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.002505	0.997482	CS pos: 19-20. Pr: 0.5303

TMHMM  Annotations     

Start	End
7	26