CAZyme Information: RhiirA1_416845-t46_1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: RhiirA1_416845-t46_1-p1
• CAZy Family: GH47
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
564		60941.33	5.4419

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisA1DAOM664342	26582	N/A	106	26476

• Gene Location: location=LLXH01000327:53239-55421(-)

Full Sequence      

MNVKLVLFAFLFGGLILLNDKTNVNALPALQARQDPGSTLGAFKIVGKSGVNAMHAVLVS
PRKVVFVDKLENNALKRPDGLSALSSEYDLDTNTAKPLGIYTNTFCSSGSWLGNGTLVEA
GGDKGDANYRSGIQTLRLYDPSVGDWVELEGIVPSNRWYPAMVTLPNGNVMILGGSTAAT
GVNRAEIDNPTYTIFPPPNGGPLTDTAFPFLSSLLPYNLYPMVHVIPNYEGKTQLFIFAN
QNGIAYDLDTGTTITTYPKIPGGIRSYPLTGTSIIIPLDPTDYYKPTVMICGGNKVYELT
SPAEASCGRLELTTPNAAWEMDEFGGQGRVMPDATFLVDGSILFVNGAATGFAGYRKGGG
ANALWVNENPVFTPFLYDPFAKTYKTLAASTIPRMYHSVSTLIPDGSVLIAGSNPQGSVS
LNVKYSTEYRVEIFYPPYLYSSTPRPNIISLQTSPINENRIPVSYGQEVTMVIQVKSDGG
NQPVLKACIIHHGFITHSQNFSQRYVYLEITNFWADSSAADQYILTIKLPPNPTIISPGP
SYIYVFNGDAPPVSGVQVLLQQAA

Enzyme Prediction     

No EC number prediction in RhiirA1_416845-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA5	39	552	9.3e-133	0.9378330373001776

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399910	Glyoxal_oxid_N	1.89e-54	82	293	45	243	Glyoxal oxidase N-terminus. This family represents the N-terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes. Glyoxal oxidase catalyzes the oxidation of aldehydes to carboxylic acids, coupled with reduction of dioxygen to hydrogen peroxide. It is an essential component of the extracellular lignin degradation pathways of the wood-rot fungus Phanerochaete chrysosporium.
199882	E_set_GO_C	9.36e-13	444	560	5	103	C-terminal Early set domain associated with the catalytic domain of galactose oxidase. E or "early" set domains are associated with the catalytic domain of galactose oxidase at the C-terminal end. Galactose oxidase is an extracellular monomeric enzyme which catalyzes the stereospecific oxidation of a broad range of primary alcohol substrates and possesses a unique mononuclear copper site essential for catalyzing a two-electron transfer reaction during the oxidation of primary alcohols to corresponding aldehydes. The second redox active center necessary for the reaction was found to be situated at a tyrosine residue. The C-terminal domain of galactose oxidase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
401164	DUF1929	1.13e-12	462	551	5	83	Domain of unknown function (DUF1929). Members of this family adopt a secondary structure consisting of a bundle of seven, mostly antiparallel, beta-strands surrounding a hydrophobic core. The 7 strands are arranged in 2 sheets, in a Greek-key topology. Their precise function, has not, as yet, been defined, though they are mostly found in sugar-utilising enzymes, such as galactose oxidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMJ52390.1|AA5	5.17e-192	49	560	131	640
CDS08707.1|AA5_1	1.98e-118	41	562	42	545
QRW24733.1|AA5_1	4.33e-95	47	558	204	724
QBZ58469.1|AA5_1|CBM18	4.63e-91	29	560	717	1246
ABD61577.1|AA5_1	1.00e-90	47	560	227	745

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WQ8_A	4.63e-20	51	552	192	651	Chain A, GALACTOSE OXIDASE [Fusarium graminearum]
1T2X_A	5.89e-20	51	552	170	629	Glactose oxidase C383S mutant identified by directed evolution [Fusarium sp.]
2EIB_A	1.04e-19	51	552	170	629	Chain A, Galactose oxidase [Fusarium graminearum]
2EIC_A	1.04e-19	51	552	170	629	Chain A, Galactose oxidase [Fusarium graminearum]
1GOF_A	1.04e-19	51	552	170	629	NOVEL THIOETHER BOND REVEALED BY A 1.7 ANGSTROMS CRYSTAL STRUCTURE OF GALACTOSE OXIDASE [Hypomyces rosellus],1GOG_A NOVEL THIOETHER BOND REVEALED BY A 1.7 ANGSTROMS CRYSTAL STRUCTURE OF GALACTOSE OXIDASE [Hypomyces rosellus],1GOH_A NOVEL THIOETHER BOND REVEALED BY A 1.7 ANGSTROMS CRYSTAL STRUCTURE OF GALACTOSE OXIDASE [Hypomyces rosellus],2EIE_A Chain A, Galactose oxidase [Fusarium graminearum],2JKX_A Chain A, GALACTOSE OXIDASE [Fusarium graminearum],2VZ1_A Chain A, GALACTOSE OXIDASE [Fusarium graminearum],2VZ3_A Chain A, Galactose Oxidase [Fusarium graminearum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q3HRQ2|GLOX_VITPS	3.90e-72	45	554	20	516	Aldehyde oxidase GLOX OS=Vitis pseudoreticulata OX=231512 GN=GLOX PE=2 SV=1
sp|Q01772|GLOX_PHACH	9.11e-72	49	549	35	539	Aldehyde oxidase GLOX OS=Phanerodontia chrysosporium OX=2822231 GN=GLX PE=1 SV=1
sp|Q9FYG4|GLOX1_ARATH	3.51e-60	49	548	105	604	Aldehyde oxidase GLOX1 OS=Arabidopsis thaliana OX=3702 GN=GLOX1 PE=2 SV=1
sp|A0A2H4HHY6|GLOX_ARTAN	4.13e-54	40	545	67	579	Putative aldehyde oxidase Art an 7 OS=Artemisia annua OX=35608 PE=1 SV=1
sp|D4AUF1|WSCD1_ARTBC	1.57e-40	88	554	466	898	WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07867 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000225	0.999759	CS pos: 26-27. Pr: 0.9624

TMHMM  Annotations     

There is no transmembrane helices in RhiirA1_416845-t46_1-p1.