CAZyme Information: RhiirA1_372990-t46_1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: RhiirA1_372990-t46_1-p1
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1059	LLXH01000041|CGC1	121707.26	6.9909

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisA1DAOM664342	26582	N/A	106	26476

• Gene Location: location=LLXH01000041:145374-148794(-)

Full Sequence      

MIAEFVTVLGIIPTGLVAFYVWLLQSRKGTLPITTTDCAYDRNKYGQILNWDKYCLYIHG
NPTLIFSGEFHYWRLPDRSRWENILKKYRAGGFNCIRIYFHWGFHNPDEGIYKFDDNRDV
DYLLNLCEKLGLYVLAAPGPYICTETQAGGFPYWLAAKDLKIRHMNFTGFKKYDKNFAEY
EKEWFEVILPIIARHQITEKSDGCVIALQIENKLFEKYRKIPFGLHDEMRFLCKVARDCG
ITVPLFTNDNNESGSFVAKPEYDINPSNNFFNRKSFGLDLYGFDKYLLFVPSDSSVLFYF
NIERDPKKWKPWETKDVVKALDNIEKVVRSFGHDAAKSPIFIPELQGGWYTSYKSDHTFD
DVYNYYGDRFTRIVYDSVLAQGCTMLSIYMTYGGTNWGTLGDIDGYTSYDYSACIREFGY
MSARLRNLRLGFLFTRSFSDVFAKTERVKKNPNITASIRGVFNLQRRAIIDSGGQGNAVV
FTFLRNFSKTKNSQFQLFVNYMEAQGDTRSFVMQCYLSYKSSFIALGNYITSTGLKLIFS
SVPIHLRILHPPSENDTGREIWIVPVNNIGEFAFEGEIDVDGNLRSSIKKIGHSINIVSF
SGGIGFARIKHAGDSKDLYILALDSDSLGTLHAAFDEPHWAQACNRSFTYSPSIVSWGTQ
NVYFDLENNIVETEYGEDEKEITILSLRKPSDHIRINSNLAYPLPFIYKKKLVVGDKSSA
VYTTPELINWSTRVTDFSDFEWQPIDLKNGGAIENNYTSGHVLYRTQFSTVKTDNKIKLV
VNMRHRCTIFVNGKFAGGHTTFNKNLFFPGAKNGPELFTSLGGNKYDITAFINNNEENNT
VVILVDNFGISRQSVIYNDVRNPRGLISAKISGLQHGTKFQWEICGVDVRNLEIPFTTSG
IPDEHDEIGWIESNISINEYGVNPNEGIRWWRFKFKHPVDSKYKEIIKVPLRLVLFGAFT
SYIFLNGILIGRYYGNGDCSQHDFYLMDGLLNFNDENQIILMIYSWEQVFSKDIIVEVRG
WEIDEVNKSGNVIRIPKDADDSDNDLKSWIIMREKIKLY

Enzyme Prediction     

No EC number prediction in RhiirA1_372990-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	56	429	8.8e-76	0.9804560260586319

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396048	Glyco_hydro_35	9.38e-62	56	419	2	302	Glycosyl hydrolases family 35.
166698	PLN03059	1.52e-22	49	428	30	338	beta-galactosidase; Provisional
224786	GanA	5.58e-18	52	212	4	159	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
404274	BetaGal_dom4_5	1.76e-05	919	1003	27	105	Beta-galactosidase jelly roll domain. This domain is found in beta galactosidase enzymes. It has a jelly roll fold.
395098	Cellulase	1.97e-04	59	148	4	102	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS09169.1|GH35	5.37e-307	1	1033	1	1011
QYN54214.1|GH35	4.22e-76	49	1012	44	941
QYN56074.1|GH35	1.59e-74	49	1012	44	941
UJF34804.1|CE20|GH35	6.23e-69	49	1005	61	942
UPG93009.1|GH35	8.33e-68	34	1008	24	930

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TG7_A	5.01e-43	47	1007	4	932	Native structure of beta-galactosidase from Penicillium sp. [Penicillium sp.],1XC6_A Native Structure Of Beta-Galactosidase from Penicillium sp. in complex with Galactose [Penicillium sp.]
5IFP_A	1.30e-42	24	1012	21	973	Structure Of Beta-galactosidase From Aspergillus Niger [Aspergillus niger CBS 513.88]
5IFT_A	3.01e-42	24	1012	21	973	STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 3-b-Galactopyranosyl glucose [Aspergillus niger CBS 513.88],5IHR_A Structure Of E298q-beta-galactosidase From Aspergillus Niger In Complex With Allolactose [Aspergillus niger CBS 513.88],5JUV_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-b-Galactopyranosyl galactose [Aspergillus niger CBS 513.88],5MGC_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 4-Galactosyl-lactose [Aspergillus niger CBS 513.88],5MGD_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-Galactosyl-lactose [Aspergillus niger CBS 513.88]
3OG2_A	8.93e-42	47	1007	24	964	Chain A, Beta-galactosidase [Trichoderma reesei],3OGR_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGS_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGV_A Chain A, Beta-galactosidase [Trichoderma reesei]
4IUG_A	1.45e-40	42	1007	39	966	Crystal structure of beta-galactosidase from Aspergillus oryzae in complex with galactose [Aspergillus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WNE4|BGALC_ASPFU	1.35e-54	49	1005	32	940	Probable beta-galactosidase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=lacC PE=3 SV=1
sp|B0Y752|BGALC_ASPFC	1.35e-54	49	1005	32	940	Probable beta-galactosidase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=lacC PE=3 SV=1
sp|A1DM65|BGALC_NEOFI	3.15e-52	49	1005	32	940	Probable beta-galactosidase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=lacC PE=3 SV=1
sp|A6RPN7|BGALB_BOTFB	3.54e-52	25	1025	20	980	Probable beta-galactosidase B OS=Botryotinia fuckeliana (strain B05.10) OX=332648 GN=lacB PE=3 SV=1
sp|B6H5X9|BGALC_PENRW	4.08e-51	39	1005	21	938	Probable beta-galactosidase C OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=lacC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000022	0.000008

TMHMM  Annotations     

Start	End
5	24
953	975