CAZyme Information: RhiirA1_368128-t46_1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: RhiirA1_368128-t46_1-p1
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
508	LLXH01000917|CGC1	57192.52	6.5691

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisA1DAOM664342	26582	N/A	106	26476

• Gene Location: location=LLXH01000917:4490-6337(+)

Full Sequence      

MSPDGFERTVWSVNGQHPGPLIQANKGDRLVINVTNHFDDPATVHWHGMFQHGTNWYDGV
PGQTQCPIPNDVSLVYNFSTTDQHGTYWYHSHFFAQYVDGLRGSLVVHDPDDPYLNQYDF
EYLVVLSDWHHNTTGVLLPLQDAPGYSGFRPIPDSPLISGLGRYNCTAAPPGSKCKSDQP
LPVYNVKKNKKYRFRIINSAADGVFVFSIDQHKLKVIESEGIYLKPTIIKKLPVAVGQRY
SVIVDANQPVGNYFIRGTLDKRCTPNNNATINFNSAIDWDGLGILHYEGAKNSPNSKEFD
DDFTPCRDLDKKHLKPIKPITKYDGHVTDFVNITITFGADKNQRLEALINNSSFVPQLND
PTINKITRDIAAKDLPKDQNSVILNHNGGIAEIYVKNDNNADHPFHMHGHVFAIMFVGEK
GDVPDESKYNKKNPVVRDTVTIPGNGFLVIRFITDNPGVWAFHCHIEWHVEIGMVMGIIE
LQDTLKKETIPEDVVALCLEHDLQKRTT

Enzyme Prediction     

No EC number prediction in RhiirA1_368128-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA1	6	474	1.8e-113	0.9776536312849162

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274555	ascorbase	2.02e-86	2	479	14	520	L-ascorbate oxidase, plant type. Members of this protein family are the copper-containing enzyme L-ascorbate oxidase (EC 1.10.3.3), also called ascorbase. This family is found in flowering plants, and shows greater sequence similarity to a family of laccases (EC 1.10.3.2) from plants than to other known ascorbate oxidases.
177843	PLN02191	5.79e-79	2	499	36	563	L-ascorbate oxidase
215324	PLN02604	5.75e-76	2	474	37	540	oxidoreductase
225043	SufI	1.89e-73	4	483	48	450	Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) [Cell cycle control, cell division, chromosome partitioning, Inorganic ion transport and metabolism, Cell wall/membrane/envelope biogenesis].
274556	laccase	1.27e-64	8	491	22	530	laccase, plant. Members of this protein family include the copper-containing enzyme laccase (EC 1.10.3.2), often several from a single plant species, and additional, uncharacterized, closely related plant proteins termed laccase-like multicopper oxidases. This protein family shows considerable sequence similarity to the L-ascorbate oxidase (EC 1.10.3.3) family. Laccases are enzymes of rather broad specificity, and classification of all proteins scoring about the trusted cutoff of this model as laccases may be appropriate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS45844.1|AA1	2.16e-106	3	501	136	658
QBZ62742.1|AA1	1.64e-105	3	498	200	722
QRW22336.1|AA1_1	9.54e-103	1	487	34	503
AEO70365.1|AA1	1.20e-102	3	498	125	658
QRW13493.1|AA1	1.53e-102	2	498	80	591

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EHF_A	2.10e-96	1	502	15	490	Laccase from Antrodiella faginea [Antrodiella faginea]
5NQ7_A	1.28e-93	1	502	36	511	Crystal structure of laccases from Pycnoporus sanguineus, izoform I [Trametes sanguinea]
3KW7_A	6.43e-93	1	502	15	495	Crystal structure of LacB from Trametes sp. AH28-2 [Trametes sp. AH28-2],3KW7_B Crystal structure of LacB from Trametes sp. AH28-2 [Trametes sp. AH28-2]
5Z1X_A	2.93e-92	1	498	15	484	Crystal Structure of Laccase from Cerrena sp. RSD1 [Cerrena],5Z1X_B Crystal Structure of Laccase from Cerrena sp. RSD1 [Cerrena],5Z22_A Crystal Structure of Laccase from Cerrena sp. RSD1 [Cerrena]
5NQ8_A	5.54e-92	1	502	36	511	Crystal structure of laccases from Pycnoporus sanguineus, izoform II [Trametes coccinea],5NQ9_A Crystal structure of laccases from Pycnoporus sanguineus, izoform II, monoclinic [Trametes sanguinea],5NQ9_C Crystal structure of laccases from Pycnoporus sanguineus, izoform II, monoclinic [Trametes sanguinea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q02081|LAC4_THACU	1.56e-94	1	478	34	494	Laccase-4 OS=Thanatephorus cucumeris OX=107832 GN=LCC4 PE=1 SV=1
sp|Q01679|LAC1_PHLRA	6.36e-94	1	498	36	509	Laccase OS=Phlebia radiata OX=5308 GN=LAC PE=1 SV=2
sp|O59896|LAC1_PYCCI	5.15e-92	1	502	36	511	Laccase OS=Pycnoporus cinnabarinus OX=5643 GN=LCC3-1 PE=1 SV=1
sp|Q02497|LAC1_TRAHI	2.56e-89	1	502	36	513	Laccase OS=Trametes hirsuta OX=5327 PE=1 SV=1
sp|Q12541|LAC1_AGABI	2.17e-87	1	502	33	513	Laccase-1 OS=Agaricus bisporus OX=5341 GN=lcc1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000075	0.000000

TMHMM  Annotations     

There is no transmembrane helices in RhiirA1_368128-t46_1-p1.