CAZyme Information: RhiirA1_361380-t46_1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: RhiirA1_361380-t46_1-p1
• CAZy Family: AA7
• CAZyme Description: chondroitin AC/alginate lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374	LLXH01000180|CGC1	44244.54	9.5277

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisA1DAOM664342	26582	N/A	106	26476

• Gene Location: location=LLXH01000180:110841-111965(+)

Full Sequence      

MLSTLLNKADNALRNNSVYSVTLKPQLAPSNDPHDFMSLARYFWPNPKKKNGLPYIGRDG
YVNPEIETVKDYSLLRKLFKDVENLGFAYYFTRNDSYVEKSVYRIKEWFINPKTKMNPNL
NYASFIKGHKSGRRTGVLDMHPIYRMLQSIPLMRSSHKWDFSVEKELKDWISKYYQWLET
TSLGKDEKYSKNNHGTYYDVQAVYLLSYLDREEEARKYSREALINRVNKGILPTGQQPHE
TKRPTSWFYSTFNLQALFLLAERSQYFGFDGWNYVGPKGQTIKKAVDYLLPFALSNGKDW
PFKNIKEFEVNSFVRLLELAFVIWPDDKYLEALVILRPKAKLEQALEYRNADWEDNYLCV
WSLMTNRQLWTCVE

Enzyme Prediction     

No EC number prediction in RhiirA1_361380-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL38	21	296	7.1e-98	0.985663082437276

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398861	Alginate_lyase	1.96e-72	20	300	1	274	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCH01052.1|PL38	7.61e-79	4	320	61	375
QMU30997.1|PL38	2.20e-78	18	329	78	388
AYQ31188.1|PL38	1.30e-77	5	341	66	400
CDS13453.1|PL38	1.81e-77	5	330	58	383
UPK66657.1|PL38	2.11e-76	2	326	57	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NFV_A	4.02e-56	2	309	30	337	Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.95 A resolution [Bacteroides ovatus ATCC 8483],3NNB_A Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.60 A resolution [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

RhiirA1_361380-t46_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000079	0.000000

TMHMM  Annotations     

There is no transmembrane helices in RhiirA1_361380-t46_1-p1.