CAZyme Information: RhiirA1_330759-t46_1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: RhiirA1_330759-t46_1-p1
• CAZy Family: PL38
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
705		82412.96	7.0253

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisA1DAOM664342	26582	N/A	106	26476

• Gene Location: location=LLXH01000278:38606-40720(-)

Full Sequence      

LIKNHFNCSPELFIRDDMKKTSLCIQQELETHHHKYPIGCSESYFESKINELTHHNEIVT
FGVLLPITSRELTKPEKCIENFSNLLKSLAETSQQNIQYRISGTRYQIKIYIGIDKDGHL
FLNNSAEKIFYNHGFIDIDITKFDYFPGSTCDIWRELSRKAYKENCDYIVLFENDIIIKT
NGWMNKFHKTYLEISIQKKVPCNFGCVTFTDITFPGFPAFPVISRVHLDTFNGDIIPQQK
FQIQDVYTYLFQLYRRWGCSIILHDVEIQKIDVDQRYEKWYHSDWKFDVLNNSVDRVEKW
LNNNNKTPIQKLLTLDIVVPSYRVDFKYLDPIINLEIPVTMSTIIYIIIDDPNSSNIILL
KKLYEKDPFIRILVNKTNLGASLSRNRGLYESNADYILFLDDDVTPEKDILFECEKVIKE
HPTACGFIGSSKFPPANESIFKSAVVLSGVTFFWEIAEIWDNDIPWGIAGNLLIKSYKDD
ILFDSSFPKTGGGEDIDFCLKKGNFFIKNVENGKGFQGAPNVKVTHHWWNDGKRYYWRFY
KWAKGDGALIKMHPNLTYNDIVPNSAEFLLGTTFILFITVIISSLITVFYDIEIINIFTI
LIFLSVPHVIISNFIFDIHLHLIIQPFKRVPTIRGYRYILAIFESSMIRMTNEFGRLMGH
IERKEWNYIGKRFDWFAKKNGGTMNDEISTNSRKFFIWVSLMVFS

Enzyme Prediction     

No EC number prediction in RhiirA1_330759-t46_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
132997	Glyco_tranf_GTA_type	2.83e-11	347	431	30	115	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
395426	Glycos_transf_2	1.47e-09	316	425	1	110	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
133029	GT_2_like_c	3.40e-08	347	430	30	110	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
224137	GT2	1.57e-07	317	558	7	253	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
133027	GT2_RfbC_Mx_like	4.68e-07	317	424	5	114	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV90438.1|GT2	1.81e-147	9	704	325	1015
QRV75675.1|GT2	1.24e-143	9	677	325	988
QRW04585.1|GT2	6.87e-134	9	677	326	992
QRW23776.1|GT2|GT8	2.03e-115	1	677	312	958
UFH56504.1|GT2	1.23e-32	314	570	25	273

PDB Hits     

RhiirA1_330759-t46_1-p1 has no PDB hit.

Swiss-Prot Hits     

RhiirA1_330759-t46_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999990	0.000043

TMHMM  Annotations     

Start	End
568	590
597	619