CAZyme Information: RhiirA1_310143-t46_1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: RhiirA1_310143-t46_1-p1
• CAZy Family: AA1
• CAZyme Description: chondroitin AC/alginate lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
275	LLXH01000180|CGC2	32629.05	9.4042

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisA1DAOM664342	26582	N/A	106	26476

• Gene Location: location=LLXH01000180:108410-109234(+)

Full Sequence      

YSVTLKPQLAPSNDPHDYMSLARYFWPDPNKPDGLPYMRKDGYSNPEIETIKDYSLLRKL
FDDVENLGFAYYFTRNDSYVEKAVYRIKEWFINPKTRMNPNLNYASFIKGQDLGRRTGII
DMRPIYRMLQSIPLMRSSRKWDHSVEKKFKIWLSKYYFWLEKTSIGIDEKESTNNHGTYY
DVQAIYLLSYLGREEEARKYSYEALINRVNEGILPTGQQPHETKRPTSWYYSTFNLQALF
LLAERSQYFGFDGWNYVGPKGQTIKKAVDYLLPFA

Enzyme Prediction     

No EC number prediction in RhiirA1_310143-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL38	3	274	2.3e-99	0.9713261648745519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398861	Alginate_lyase	4.11e-73	2	275	1	268	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCH01052.1|PL38	1.69e-75	1	275	75	349
QIP15531.1|PL38	2.76e-74	1	275	71	345
AYQ31188.1|PL38	3.22e-73	1	274	80	352
CDS13453.1|PL38	4.33e-73	1	275	72	346
SOE20097.1|PL38	1.58e-72	2	275	82	355

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NFV_A	1.45e-53	2	274	47	320	Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.95 A resolution [Bacteroides ovatus ATCC 8483],3NNB_A Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.60 A resolution [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

RhiirA1_310143-t46_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000043	0.000004

TMHMM  Annotations     

There is no transmembrane helices in RhiirA1_310143-t46_1-p1.