CAZyme Information: RVD90388.1

Basic Information

• Species: Arthrobotrys flagrans
• Lineage: Ascomycota; Orbiliomycetes; ; Orbiliaceae; Arthrobotrys; Arthrobotrys flagrans
• CAZyme ID: RVD90388.1
• CAZy Family: GT90
• CAZyme Description: CBM1 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A437AH43]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
397		42071.74	7.3240

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflagransCBSH-5679	9927	N/A	30	9897

• Gene Location: location=SAEB01000001:4953508-4954824(+)

Full Sequence      

MVTKVLLGLALAAAVNAQAQPYAQCGGTGFTGSTTCVSGWTCVYSNEWYSQCLQSTGTTA
ATTTSTKTTTKSTTTSTKTTATTTKASTTLATSTTKTSLQPAASGSCIAQCTVGYCTLNG
GTTGGVGGTVTTVSTLEALVSALNNDNPKIVYISGTISGNQQVDVGSNTHVIGKSGSQLI
GVGFRAWRRKNIIFSNLKISKCLAPIDNILIQETTNVLVDHCDLSSDQDHDKDYYDGALD
MSHATDFVTVSNTFIHDHYKCSLIGHSDNNAAEDTGHLRVTYLRNRWSGCNSRQPSVRFG
TVHVVNNYFENSSLGYTSRMGAQMLVEYSKWVNVASIDYEESKATGYVVTRGNDYGTGKT
PILPVGTLSSVPYSYSTLAVGDVDSYTSANAGQRLSC

Enzyme Prediction     

EC	4.2.2.2:30

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	153	331	4.1e-74	0.988950276243094

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	4.83e-47	153	334	2	189	Amb_all domain.
226384	PelB	7.06e-42	136	392	65	340	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	8.98e-30	162	327	29	207	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.
197593	fCBD	1.42e-05	21	53	2	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
395595	CBM_1	0.003	36	49	16	29	Fungal cellulose binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGX48790.1|CBM1|PL1	1.48e-243	1	397	1	400
QRW19897.1|PL1_7	5.18e-93	112	395	35	314
QRW19905.1|PL1_7	1.47e-92	112	395	35	314
BCR87486.1|PL1_7	3.05e-91	114	396	41	323
QRW19895.1|PL1_7	1.33e-90	112	395	35	314

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VMV_A	1.78e-31	114	392	6	321	Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 [Bacillus sp. N16-5],3VMW_A Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 in complex with trigalacturonate [Bacillus sp. N16-5]
1PCL_A	1.14e-22	112	309	8	246	Chain A, PECTATE LYASE E [Dickeya chrysanthemi]
5AMV_A	3.37e-20	121	313	20	299	Structural insights into the loss of catalytic competence in pectate lyase at low pH [Bacillus subtilis],5X2I_A Polygalacturonate Lyase by Fusing with a Self-assembling Amphipathic Peptide [Bacillus subtilis subsp. subtilis str. 168]
1BN8_A	3.97e-20	121	313	41	320	Bacillus Subtilis Pectate Lyase [Bacillus subtilis]
2BSP_A	9.79e-20	121	313	41	320	Chain A, PROTEIN (PECTATE LYASE) [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CYB8|PLYA_NEOFI	1.67e-81	114	395	38	319	Probable pectate lyase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyA PE=3 SV=1
sp|Q4WIT0|PLYA_ASPFU	5.28e-80	114	395	38	319	Probable pectate lyase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyA PE=3 SV=1
sp|B0XT32|PLYA_ASPFC	5.28e-80	114	395	38	319	Probable pectate lyase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyA PE=3 SV=1
sp|Q9C2Z0|PLYA_ASPNG	1.12e-79	108	395	34	321	Pectate lyase A OS=Aspergillus niger OX=5061 GN=plyA PE=1 SV=1
sp|A2QV36|PLYA_ASPNC	1.12e-79	108	395	34	321	Probable pectate lyase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=plyA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000267	0.999698	CS pos: 19-20. Pr: 0.7667

TMHMM  Annotations     

There is no transmembrane helices in RVD90388.1.