CAZyme Information: RVD89842.1

Basic Information

• Species: Arthrobotrys flagrans
• Lineage: Ascomycota; Orbiliomycetes; ; Orbiliaceae; Arthrobotrys; Arthrobotrys flagrans
• CAZyme ID: RVD89842.1
• CAZy Family: GT61
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376	SAEB01000001|CGC5	41874.59	6.7212

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflagransCBSH-5679	9927	N/A	30	9897

• Gene Location: location=SAEB01000001:3289913-3291259(+)

Full Sequence      

MAPLNVGFVGYGFATRCFHLPYILPNPDLKVYAFLQRAEAPRAGSSVEKGKHCTVDYPQA
KHYRTAEEFFADPNIDLVIVCTHHDSHFEFAEKSLLAGKHVVVEKPFTPTAAEADKLIAL
SKEKGKVLTVFQNRRYDSDFRTLHSLAEKGVFGQLTDVTIHYDVDLPPWVANWKGGEYKP
GDGIMYGLGSHSVDQALLLIGQTPTSVTGFYRTLRPSDSDIDDTFIIILQFGGELKKLIA
TVTTSVVTPMEQPLKYLIRGYDGSFIKYGEDSQETQLLGGMESTDPKFGVEDPSIYGKLC
TKTQVHEGQILDNRTKRYIGTVPSMTGSYIKYYSDLAEAIKTGKEPFVKAQQSRDGIRVI
ELARQSAQEGRSIPWS

Enzyme Prediction     

No EC number prediction in RVD89842.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	4	172	4.3e-20	0.42105263157894735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
183212	PRK11579	4.16e-70	4	374	5	344	putative oxidoreductase; Provisional
182305	PRK10206	9.23e-68	4	367	2	335	putative oxidoreductase; Provisional
223745	MviM	3.03e-66	1	374	1	339	Predicted dehydrogenase [General function prediction only].
396129	GFO_IDH_MocA	4.77e-28	4	130	1	118	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
275173	myo_inos_iolG	4.95e-21	3	373	1	329	inositol 2-dehydrogenase. All members of the seed alignment for this model are known or predicted inositol 2-dehydrogenase sequences co-clustered with other enzymes for catabolism of myo-inositol or closely related compounds. Inositol 2-dehydrogenase catalyzes the first step in inositol catabolism. Members of this family may vary somewhat in their ranges of acceptable substrates and some may act on analogs to myo-inositol rather than myo-inositol per se. [Energy metabolism, Sugars]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAT16263.1|GH13|GH133|GH23|GT2|GT4|GT5	6.09e-13	66	162	37862	37958
QRX64436.1|GH0	1.60e-11	2	238	60	313
SCM55249.1|GH0	1.22e-10	3	238	61	314
VEH15064.1|GH109	4.59e-10	1	268	103	392
QUB39974.1|GH109	7.67e-10	1	289	64	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3F4L_A	2.29e-60	4	367	3	336	Crystal structure of a probable oxidoreductase yhhX in Triclinic form. Northeast Structural Genomics target ER647 [Escherichia coli K-12],3F4L_B Crystal structure of a probable oxidoreductase yhhX in Triclinic form. Northeast Structural Genomics target ER647 [Escherichia coli K-12],3F4L_C Crystal structure of a probable oxidoreductase yhhX in Triclinic form. Northeast Structural Genomics target ER647 [Escherichia coli K-12],3F4L_D Crystal structure of a probable oxidoreductase yhhX in Triclinic form. Northeast Structural Genomics target ER647 [Escherichia coli K-12],3F4L_E Crystal structure of a probable oxidoreductase yhhX in Triclinic form. Northeast Structural Genomics target ER647 [Escherichia coli K-12],3F4L_F Crystal structure of a probable oxidoreductase yhhX in Triclinic form. Northeast Structural Genomics target ER647 [Escherichia coli K-12]
3GDO_A	1.39e-58	4	373	6	346	Crystal structure of putative oxidoreductase yvaA from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],3GDO_B Crystal structure of putative oxidoreductase yvaA from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168]
3GFG_A	1.76e-58	4	373	15	355	Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_B Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_C Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_D Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_E Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_F Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_G Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_H Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_I Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_J Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_K Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_L Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168]
3FHL_A	2.56e-56	4	373	6	351	Crystal structure of a putative oxidoreductase from bacteroides fragilis nctc 9343 [Bacteroides fragilis NCTC 9343],3FHL_B Crystal structure of a putative oxidoreductase from bacteroides fragilis nctc 9343 [Bacteroides fragilis NCTC 9343],3FHL_C Crystal structure of a putative oxidoreductase from bacteroides fragilis nctc 9343 [Bacteroides fragilis NCTC 9343],3FHL_D Crystal structure of a putative oxidoreductase from bacteroides fragilis nctc 9343 [Bacteroides fragilis NCTC 9343]
3I23_A	1.41e-55	4	361	3	333	Crystal Structure of an Oxidoreductase (Gfo/Idh/MocA family) from Enterococcus faecalis. Northeast Structural Genomics Consortium target id EfR167 [Enterococcus faecalis],3I23_B Crystal Structure of an Oxidoreductase (Gfo/Idh/MocA family) from Enterococcus faecalis. Northeast Structural Genomics Consortium target id EfR167 [Enterococcus faecalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13991|YEG9_SCHPO	6.74e-62	1	376	1	368	Uncharacterized oxidoreductase C26H5.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC26H5.09c PE=2 SV=3
sp|O42896|YBQ3_SCHPO	1.30e-61	1	373	1	366	Uncharacterized oxidoreductase C115.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC115.03 PE=3 SV=1
sp|P46853|YHHX_ECOLI	1.51e-60	4	367	3	336	Uncharacterized oxidoreductase YhhX OS=Escherichia coli (strain K12) OX=83333 GN=yhhX PE=1 SV=1
sp|O32223|IOLW_BACSU	7.15e-58	4	373	14	354	scyllo-inositol 2-dehydrogenase (NADP(+)) IolW OS=Bacillus subtilis (strain 168) OX=224308 GN=iolW PE=1 SV=1
sp|P77376|YDGJ_ECOLI	1.86e-54	4	367	5	337	Uncharacterized oxidoreductase YdgJ OS=Escherichia coli (strain K12) OX=83333 GN=ydgJ PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000043	0.000000

TMHMM  Annotations     

There is no transmembrane helices in RVD89842.1.