CAZyme Information: RVD89763.1

Basic Information

• Species: Arthrobotrys flagrans
• Lineage: Ascomycota; Orbiliomycetes; ; Orbiliaceae; Arthrobotrys; Arthrobotrys flagrans
• CAZyme ID: RVD89763.1
• CAZy Family: GT59
• CAZyme Description: Endo-1,3(4)-beta-glucanase [Source:UniProtKB/TrEMBL;Acc:A0A437AEN4]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
784	SAEB01000001|CGC6	86696.03	9.3018

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflagransCBSH-5679	9927	N/A	30	9897

• Gene Location: location=SAEB01000001:2988866-2991636(-)

Full Sequence      

MTKKDMEPTLQIENPAPVILSSPADGKQFPLGDEFPNFGSIGYNNRNDSGISYAAVHAAH
DVRPAADDIMDQPISTNAPPAMFERKNDHPVDRLGVINMDGVPVGTNKFWANLILGNGNL
GVFTQPYQVWINKDPAMWGLSISHIDAPQIVTGPDPNANPVQYYFNPVGVNSFTFSAQEL
NPATSTVTVEALKPHSALVQIWVDRSRWPGTRRLTVPLVQGMGFVTGRYREITPKINSGV
LIRSLSYVGTITGGGMPRQKWRVTLMDGKEWRIYATANSGSRELQLRLVNSSTIAASGTY
SGAVQISKLPNTALEKVLDNCAGTVVTDAVVSASVSGAVGTYTFTFVKQGGSVSNSAFMY
AFPHQVNSFDGTTRSKLQAGLQLKSTTKGLMTAIASNSWTLLEPNMPVSVSWLPGSFRKW
TMKQLTTIKAAIVSEIGFDVINASDMPSQYFAGKVLTKYAQILLVASEVLKDKALVQRGL
ANLRTALNRFATNKQKFPLVYDTKWGGLPSSSWWVSKNPGEDFGNAWYNDHHFHYGYFIY
AAAVLVHVEKTQTGSSPWLAQNSAYVNSLVRDVANPTPKDKYFPVSRSFDFFNGHSWATG
LYPRADGKDEESTSEDYNFSYAMKLWGNVIGNKNMEARANLQLAIMKRSFNSYFLLSSDN
RYQPSNFIQNKVTGILFENKVDHTTYFGNQIEYIQGIHMLPLTPISPYVRSKTFCYEEWQ
RFFDGRTEAMNSGWKGVLWANAAIFAPNAAFDFFASQNFQANWLDDGASRTWYLVFAAGL
GGGQ

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	98	776	6.2e-209	0.977491961414791

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	0.0	423	774	5	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	0.0	69	782	54	757	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	3.20e-127	89	416	1	320	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGX44161.1|GH81	0.0	1	783	1	785
APA08036.1|GH81	1.90e-211	65	782	178	888
BCS08078.1|GH81	1.30e-207	73	783	183	894
BCR95538.1|GH81	5.09e-207	73	783	228	939
QSZ30780.1|GH81	1.53e-205	51	782	37	760

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	2.50e-89	73	778	11	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	4.17e-89	73	778	36	741	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	9.35e-86	73	778	11	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	9.56e-25	326	750	225	630	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	4.83e-19	289	750	207	654	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	1.48e-191	65	779	189	901	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	2.53e-180	89	782	21	704	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|P53753|ENG1_YEAST	2.30e-162	74	780	406	1112	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	3.69e-160	74	779	432	1140	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|Q12168|ENG2_YEAST	4.73e-153	61	777	67	775	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000001

TMHMM  Annotations     

There is no transmembrane helices in RVD89763.1.