CAZyme Information: RVD89656.1

Basic Information

• Species: Arthrobotrys flagrans
• Lineage: Ascomycota; Orbiliomycetes; ; Orbiliaceae; Arthrobotrys; Arthrobotrys flagrans
• CAZyme ID: RVD89656.1
• CAZy Family: GT4
• CAZyme Description: Glucanase [Source:UniProtKB/TrEMBL;Acc:A0A437AEW9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
401		44027.68	5.7633

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflagransCBSH-5679	9927	N/A	30	9897

• Gene Location: location=SAEB01000001:2572165-2573656(+)

Full Sequence      

MRGLLTYATASLLAAPALAGPLLSTRSGNNQDRCNHDNPFKDVTVYANYRYATKLRQTIA
AFEAKGDAAGVAAAKILQKTPTFIWLSSIYDISYLEPQLLDAKADQDANWEQRTIPLVIY
NLPGRDCAALASAGEIPLGPNALNIYKSEYIDPIVALIRKYNSLRYVIVLEPDSLANLVT
NMHIPACAQASAIYKAGVAYAISQLQDKNVAVYLDIGHSNWLGWPANLQPTAKLFAEVKQ
WAGQRTNKFRGFVSNVSGYNAYNSTTPDPIYGLGPDNSNWNEWRFFKSLTPYLINNNLPT
KFIVDQGRAGVSGIRSQSINWCNIDGAGIGTRPTIKTDDCNVDAIVWVKPPGESDGTSNE
NAARFDATCRSEDAFVPSPEAGDWHEEYIEMLIKNANPPLV

Enzyme Prediction     

EC	3.2.1.91:55	3.2.1.4:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH6	58	361	2.4e-84	0.9625850340136054

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396075	Glyco_hydro_6	6.83e-142	67	364	1	293	Glycosyl hydrolases family 6.
227616	CelA1	8.20e-50	37	400	23	443	Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGX43996.1|GH6	3.30e-278	1	401	1	401
QRV87995.1|CBM1|GH6	3.09e-109	37	400	102	458
BAH08704.1|GH6|3.2.1.91	6.26e-109	11	400	5	398
QRW02170.1|CBM1|GH6	2.71e-107	37	400	102	457
BAH08706.1|GH6	2.08e-106	38	400	30	395

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3A64_A	3.06e-108	51	400	27	379	Chain A, Cellobiohydrolase [Coprinopsis cinerea],3A9B_A Chain A, Cellobiohydrolase [Coprinopsis cinerea],3ABX_A Chain A, Cellobiohydrolase [Coprinopsis cinerea]
3VOF_A	4.92e-107	51	400	27	379	Chain A, Cellobiohydrolase [Coprinopsis cinerea]
3VOG_A	4.46e-105	38	400	8	362	Chain A, Cellobiohydrolase [Coprinopsis cinerea],3VOH_A Chain A, Cellobiohydrolase [Coprinopsis cinerea],3VOI_A Chain A, Cellobiohydrolase [Coprinopsis cinerea]
3VOJ_A	7.17e-104	38	400	8	362	Chain A, Cellobiohydrolase [Coprinopsis cinerea]
5XCY_A	4.87e-95	37	400	3	358	Chain A, Glucanase [Phanerodontia chrysosporium],5XCZ_A Chain A, Glucanase [Phanerodontia chrysosporium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P49075|GUX3_AGABI	1.12e-101	38	400	90	438	Exoglucanase 3 OS=Agaricus bisporus OX=5341 GN=cel3 PE=1 SV=1
sp|B2AE04|CEL6C_PODAN	1.10e-91	8	401	7	398	1,4-beta-D-glucan cellobiohydrolase CEL6C OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=CEL6C PE=1 SV=1
sp|P46236|GUNB_FUSOX	2.53e-88	37	398	105	459	Putative endoglucanase type B OS=Fusarium oxysporum OX=5507 PE=2 SV=1
sp|Q9C1S9|GUX6_HUMIN	6.52e-86	38	399	118	475	Exoglucanase-6A OS=Humicola insolens OX=34413 GN=cel6A PE=1 SV=1
sp|B2AC20|CEL6B_PODAN	2.04e-85	13	398	39	409	1,4-beta-D-glucan cellobiohydrolase CEL6B OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=CEL6B PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000537	0.999424	CS pos: 19-20. Pr: 0.9135

TMHMM  Annotations     

There is no transmembrane helices in RVD89656.1.