CAZyme Information: RVD89563.1

Basic Information

• Species: Arthrobotrys flagrans
• Lineage: Ascomycota; Orbiliomycetes; ; Orbiliaceae; Arthrobotrys; Arthrobotrys flagrans
• CAZyme ID: RVD89563.1
• CAZy Family: GT39
• CAZyme Description: CBM1 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A437AE45]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
411	SAEB01000001|CGC13	42426.47	7.7350

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflagransCBSH-5679	9927	N/A	30	9897

• Gene Location: location=SAEB01000001:2206243-2207750(-)

Full Sequence      

MTVKILFLAPMGIGSLATPILEKRACADLYGQCGGSGWTGATCCNAGVCAYSNPWYSQCL
AGSAATMTTTKTTTSQASNPTTGTGSSAVKGSPMGFASGVTGGGNVAPVYPSNIAQLESY
LTSSSPQVIIISGTYNFVGSEGTTTYKARNAYSCTPANGGQMLLNTLGGCESLATSDITI
DNAGYAGINVKSDKTLVGINNAVLNGKGLRLVGVSNIIIQNIAITNLNPKYVWGGDAISL
SGTSKVWIDHVTTSSLGRQHYSFGRDPNKGIAISNSLINGMTSYSATCDKHTYWALELVG
NDDQITFYKNHVYYTSGRSLALSGNTLFHAINSVWSSNSGHALEGTTTTGRSLFEGCVFT
NVPTTVSGTYPGQLFTSESAYCGIFVGSSVPAAASAASIQNTVPSSAGNTL

Enzyme Prediction     

EC	4.2.2.10:25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	178	361	5.9e-70	0.9893048128342246

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	2.06e-38	177	363	1	190	Amb_all domain.
197593	fCBD	1.52e-10	29	60	2	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
395595	CBM_1	5.85e-10	29	56	1	29	Fungal cellulose binding domain.
226384	PelB	1.83e-09	91	308	32	213	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	2.54e-04	188	254	30	98	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACE00421.1|PL1_4	1.34e-148	86	411	12	367
BCS09179.1|PL1_4	6.94e-147	86	411	15	370
BCR96677.1|PL1_4	6.94e-147	86	411	15	370
CCD51880.1|PL1_4	2.52e-143	86	411	33	388
ATZ52739.1|PL1_4	2.52e-143	86	411	33	388

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IDK_A	7.94e-79	89	383	3	299	Pectin Lyase A [Aspergillus niger]
1IDJ_A	1.10e-75	89	383	3	299	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
1QCX_A	2.18e-75	89	380	3	297	Pectin Lyase B [Aspergillus niger]
2QY1_A	1.91e-07	93	271	2	161	Chain A, Pectate lyase II [Xanthomonas campestris pv. campestris],2QY1_B Chain B, Pectate lyase II [Xanthomonas campestris pv. campestris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B3GQR3|PELE_ASPNG	2.38e-149	86	411	12	367	Probable pectin lyase E OS=Aspergillus niger OX=5061 GN=pelE PE=3 SV=1
sp|Q5BEB9|PELC_EMENI	2.22e-93	89	411	20	373	Probable pectin lyase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelC PE=3 SV=2
sp|Q5BA61|PELB_EMENI	5.35e-93	84	387	17	327	Pectin lyase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelB PE=2 SV=1
sp|A2QW65|PELC_ASPNC	1.00e-91	89	380	21	311	Probable pectin lyase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelC PE=3 SV=1
sp|Q5MBK3|PELC_ASPNG	1.31e-90	89	380	21	311	Probable pectin lyase C OS=Aspergillus niger OX=5061 GN=pelC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000735	0.999214	CS pos: 24-25. Pr: 0.9426

TMHMM  Annotations     

There is no transmembrane helices in RVD89563.1.