CAZyme Information: RVD89391.1

Basic Information

• Species: Arthrobotrys flagrans
• Lineage: Ascomycota; Orbiliomycetes; ; Orbiliaceae; Arthrobotrys; Arthrobotrys flagrans
• CAZyme ID: RVD89391.1
• CAZy Family: GT31
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
629	SAEB01000001|CGC8	68881.78	5.4342

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflagransCBSH-5679	9927	N/A	30	9897

• Gene Location: location=SAEB01000001:1582216-1584248(-)

Full Sequence      

MFISRLVAPIVTLFLCLGEGNVVEALTASAFAAYPFDYIIVGGGTAGLVVANRLSANPNI
KVGVLEAGASGLDDPIIYTPGKVGWAVGTSYDWNFETIEQPVLNDRKLGWSRGKALGGSS
AINFYVWMRGNKPDYDAWANLGNAGWDFDSMIPYFKKPEHFHEPSPTDATNFKLDYVTAD
HGSTGPINTCYSIQYGGSHQYWHDTLNNLGVPRRDTFGGSNWGVWTGLTSVNPNNRTRSY
SASQYYLPFSYRTNLHVLTNAMVRKVVIQNVGGHQTATGVVFTHGGVDYTVNAASEVILS
AGTVQSPQILELSGVGNPTVLSAAGIPLKVNSPKVGENLQDRIMTVMLYEIDPSVENQDP
LQDPIELAELELEYNTNHTGLLTVLPTDFAYVPLHYFLNSTYVNYLRGLVTGTDDRTNNI
KSKLNHTLDLGSMEFVFDPNQLFPLITPEPGKKYGTVFQMLQYPFSTGSIHIPAAVGGVS
PTSDDHPIIDPKYYEGDGIVDMYTMAEAQKFADSIARESPLSSIIVQRVVPPEPAPGTET
DWLQYVKDTTISDWHPIGTCAMGGTGGIADGVVDEKLKVYGVKRLRVVDASIIPVQISSH
LQGTVYAIAEKGADMILQDYQCKRRRRRR

Enzyme Prediction     

No EC number prediction in RVD89391.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	36	619	1.1e-175	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.10e-95	36	617	6	532	choline dehydrogenase; Validated
225186	BetA	4.53e-94	36	619	8	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	3.13e-58	37	617	2	487	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	2.49e-33	464	611	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.20e-30	104	341	15	215	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD87580.1|AA3_2	8.58e-193	31	619	7	607
QMW26329.1|AA3_2	8.58e-193	31	619	7	607
UNI22347.1|AA3_2	6.91e-192	26	619	12	609
UCK58874.1|AA3_2	1.58e-190	31	619	7	607
ATY67138.1|AA3_2	6.04e-181	26	619	11	610

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	1.44e-81	36	619	6	567	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	7.19e-68	36	619	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	3.84e-67	36	619	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6XUT_A	6.23e-61	36	616	17	587	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]
6ZE2_A	1.79e-60	36	621	6	587	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A142PTM2|CITC_MONPU	1.76e-98	31	627	9	619	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A161CEV4|CITC_MONRU	1.76e-98	31	627	9	619	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	1.70e-97	36	617	47	616	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	1.70e-97	36	617	47	616	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	8.75e-94	37	620	15	620	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.267114	0.732857	CS pos: 25-26. Pr: 0.6526

TMHMM  Annotations     

There is no transmembrane helices in RVD89391.1.