CAZyme Information: RVD89022.1

Basic Information

• Species: Arthrobotrys flagrans
• Lineage: Ascomycota; Orbiliomycetes; ; Orbiliaceae; Arthrobotrys; Arthrobotrys flagrans
• CAZyme ID: RVD89022.1
• CAZy Family: GT2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
862	SAEB01000001|CGC1	95731.36	7.7239

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflagransCBSH-5679	9927	N/A	30	9897

• Gene Location: location=SAEB01000001:184638-187349(+)

Full Sequence      

MFSRLSKFKDKVHSLADEVHDKLHTNDGGPSSSSAYPGQHHQAPPIPEKPHQQHKPPRIP
PKPVSAEAYAILRKRWMNIIVGDFTHIDTSNKQIHDHIAKMSWRTGKLLETYNPGPTQVF
NNCGPFCATTVHFKNTCGRLLGLAIAWTTPGTRQYQDPDVLQKLLHGIDVVYENFFIKMA
EDIKKCIQTRQNWWNIQIGAPQNLADLGVILYAHLTPTRREQLGSKIIELAGNPFLPSLK
GGNRSWVARILIVTGIFTDNATTINTGIRCLSADGGSANVRKNTLFGYIQPGDGEGLYKD
GSLISHDVYRYAGGYGLIMLGSIARLLNLLNSEESPEEFRVKDEHVGIIYHSVERNFLPV
VWQGIIFEHVRGRGIARREGSGWDNGHALIHATALLTLGSPATLTPHLSSYVHLWHTSNP
RDIFLKAEIPQISTLQTILSNPSLPIAPNPKGCFATPIQEHFAYHSETDDWCFTLSMSST
RIGRSETLNNENLRSWYQGDGMTYLYTSTHKTHFADDYWPTMDPLHCPGTTNHQSPIPSP
MPYKSMGYKPWSGGVCWNSGGWGNGVAYGSNSVGARFAAISMDHLALDRHSSAKKSWFLT
EKGIIALGACVASDISPAAEVHTTIESRNLDQPGRLVVINGQEYTDTPGWVKRSGRVHWT
WLENTGGYIFLDAKDPKPTEKVFKREKKCGCWRDVTGDGKADEICREYVSVIINHGVNPK
DGKYAYAILPLATREQTGEAQANPPWNILRNDGNVQAVEYTYPEGELLFATLWSGGEVNG
IKVDKGCQLIWGRWNGEWCLSVSDPEHRNGLEVVVEVAEVVRRGLRVGRKDEGVSVEGGR
VVVKGLKDGAGKSVVFGERDEL

Enzyme Prediction     

No EC number prediction in RVD89022.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL8	466	734	9.1e-60	0.9420849420849421

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238517	GAG_Lyase	1.65e-116	68	805	1	693	Glycosaminoglycan (GAG) polysaccharide lyase family. This family consists of a group of secreted bacterial lyase enzymes capable of acting on glycosaminoglycans, such as hyaluronan and chondroitin, in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen. These are broad-specificity glycosaminoglycan lyases which recognize uronyl residues in polysaccharides and cleave their glycosidic bonds via a beta-elimination reaction to form a double bond between C-4 and C-5 of the non-reducing terminal uronyl residues of released products. Substrates include chondroitin, chondroitin 4-sulfate, chondroitin 6-sulfate, and hyaluronic acid. Family members include chondroitin AC lyase, chondroitin abc lyase, xanthan lyase, and hyalurate lyase.
396729	Lyase_8	3.30e-57	468	730	14	249	Polysaccharide lyase family 8, super-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
400444	Lyase_8_N	3.12e-44	76	413	1	322	Polysaccharide lyase family 8, N terminal alpha-helical domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
397152	Lyase_8_C	8.85e-06	749	809	1	63	Polysaccharide lyase family 8, C-terminal beta-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGX45603.1|PL8	0.0	1	862	35	883
EGX53964.1|PL8	1.92e-136	72	840	29	759
BCJ33215.1|PL8	6.85e-96	65	823	34	764
BCJ39126.1|PL8	2.18e-93	65	856	38	791
AXE81470.1|PL8	1.59e-89	65	805	45	757

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RW9_A	7.83e-74	65	808	5	706	Crystal structure of the Arthrobacter aurescens chondroitin AC lyase [Paenarthrobacter aurescens]
1RWA_A	1.49e-73	65	808	5	706	Crystal structure of Arthrobacter aurescens chondroitin AC lyase [Paenarthrobacter aurescens],1RWC_A Crystal structure of Arthrobacter aurescens chondroitin AC lyase [Paenarthrobacter aurescens],1RWF_A Crystal structure of Arthrobacter aurescens chondroitin AC lyase in complex with chondroitin tetrasaccharide [Paenarthrobacter aurescens],1RWG_A Crystal structure of Arthrobacter aurescens chondroitin AC lyase in complex with chondroitin tetrasaccharide [Paenarthrobacter aurescens],1RWH_A Crystal structure of Arthrobacter aurescens chondroitin AC lyase in complex with chondroitin tetrasaccharide [Paenarthrobacter aurescens]
6F2P_A	4.29e-61	113	817	51	708	Structure of Paenibacillus xanthan lyase to 2.6 A resolution [Paenibacillus]
2E22_A	7.77e-59	139	844	74	726	Crystal structure of xanthan lyase in complex with mannose [Bacillus sp. GL1]
2E24_A	7.77e-59	139	844	74	726	Chain A, Xanthan lyase [Bacillus sp. GL1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9AQS0|XANLY_BACGL	1.90e-57	65	844	25	751	Xanthan lyase OS=Bacillus sp. (strain GL1) OX=84635 GN=xly PE=1 SV=1
sp|P0CZ00|HYSA_CUTAC	1.34e-45	67	816	37	756	Hyaluronate lyase OS=Cutibacterium acnes OX=1747 PE=1 SV=1
sp|P0CZ01|HYSA_CUTAK	1.80e-45	67	816	37	757	Hyaluronate lyase OS=Cutibacterium acnes (strain DSM 16379 / KPA171202) OX=267747 GN=PPA0380 PE=3 SV=1
sp|Q53591|HYSA_STRA3	3.73e-43	65	758	248	925	Hyaluronate lyase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=hylB PE=1 SV=2
sp|Q59801|HYSA_STAA8	2.47e-41	64	839	44	800	Hyaluronate lyase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=hysA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000037	0.000000

TMHMM  Annotations     

There is no transmembrane helices in RVD89022.1.