CAZyme Information: RVD88789.1

Basic Information

• Species: Arthrobotrys flagrans
• Lineage: Ascomycota; Orbiliomycetes; ; Orbiliaceae; Arthrobotrys; Arthrobotrys flagrans
• CAZyme ID: RVD88789.1
• CAZy Family: PL1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
494	SAEB01000003|CGC6	55473.01	8.8145

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflagransCBSH-5679	9927	N/A	30	9897

• Gene Location: location=SAEB01000003:5426142-5427758(-)

Full Sequence      

MPTHRPSILFLTHPELGQANVHLATLYELLLTRKYDLHVASFQDKNLDKSLGFIVDFAHE
NATSSAADGSANPKETVKRHTVVGVSMQVIHPDPRTQAHSPRFKKFRKHFKPTFGKLLNH
QEADGYADSVQSVVEIIKDVRPAVAVVDSLFWQGFDAVRLTKQPYVVLWPNFLKECIGGM
MPKVKTMWKVPVSGTGYSYPVPLHLKPANMYIFFTFFTAIMNSSKRKAIDKRRKAMGLKG
PHPILDLEGAPQVTPCLPEIDYPFKFNEEIITNCGPIIFPSSIKPNDPLLVWIKRAPTVL
INLGTHCNFYENHATEVLKGIRTVIDKLPNVQILWKWKEVESHTGLVEKFIGKEEGRVKI
VRWLENSPMDLLNTGDIVCNVHHGGANSFYEALWAGVPHVILPKWFDNYDMAARAEWLGV
GVWASRKTAPDENAEELAAGILTVLEDGPRATSIKENCVKYATITQASGGRKQAADKIGE
YARLYEVKDSTENL

Enzyme Prediction     

No EC number prediction in RVD88789.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.22e-32	73	447	37	375	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	2.49e-19	8	483	4	400	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
178170	PLN02555	1.14e-10	284	477	262	458	limonoid glucosyltransferase
273616	MGT	1.61e-10	127	478	78	386	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
215127	PLN02210	2.07e-07	284	470	254	440	UDP-glucosyl transferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGX52867.1|GT1	0.0	1	494	1	495
CAP85999.1|GT1	3.31e-87	1	483	1	469
QSZ37360.1|GT1	4.56e-87	2	484	42	523
QMW30045.1|GT1	4.08e-82	7	478	5	477
UDD61742.1|GT1	4.08e-82	7	478	5	477

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KQX_A	7.80e-08	264	487	186	390	Chain A, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168],7BOV_A Chain A, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
6KQW_A	1.02e-07	264	476	186	380	Chain A, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
6IPB_A	4.59e-07	280	464	20	189	Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_B Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_C Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_D Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens]
7CJX_A	1.05e-06	299	460	25	164	Chain A, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_B Chain B, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_C Chain C, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_D Chain D, UDP-glucuronosyltransferase 2B15 [Homo sapiens]
2O6L_A	2.79e-06	299	464	24	167	Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens],2O6L_B Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1B4XBH6|SDNJ_SORAA	1.54e-75	1	476	1	500	Glycosyltransferase sdnJ OS=Sordaria araneosa OX=573841 GN=sdnJ PE=1 SV=1
sp|A0A411KZY6|BUAB_ASPBU	4.35e-66	1	456	1	452	Glycosyltransferase buaB OS=Aspergillus burnettii OX=2508778 GN=buaB PE=3 SV=1
sp|M9MH90|EMT1_PSEA3	4.79e-13	338	488	421	569	Erythritol-mannosyl-transferase 1 OS=Pseudozyma antarctica (strain T-34) OX=1151754 GN=EMT1 PE=1 SV=1
sp|A0A0D1DZV5|EMT1_USTMA	7.95e-12	338	492	420	572	Erythritol-mannosyl-transferase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=EMT1 PE=1 SV=1
sp|Q16880|CGT_HUMAN	5.10e-11	260	456	248	431	2-hydroxyacylsphingosine 1-beta-galactosyltransferase OS=Homo sapiens OX=9606 GN=UGT8 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000035	0.000001

TMHMM  Annotations     

There is no transmembrane helices in RVD88789.1.