CAZyme Information: RVD88596.1

Basic Information

• Species: Arthrobotrys flagrans
• Lineage: Ascomycota; Orbiliomycetes; ; Orbiliaceae; Arthrobotrys; Arthrobotrys flagrans
• CAZyme ID: RVD88596.1
• CAZy Family: GT15
• CAZyme Description: CAP10 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A437ABT9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
901	SAEB01000003|CGC16	102059.53	8.6885

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflagransCBSH-5679	9927	N/A	30	9897

• Gene Location: location=SAEB01000003:4736874-4739785(-)

Full Sequence      

MNILNSYLLTSISGSSSGSEPKSNGILITNIFLTTLVTSIFTPELHSLLVSAISWCTVAV
ILFMVRKQAARNGELQVTIDRKTRRKVTALVWCILLSGICERVVGPAWTGKAAWWNKAGL
PLVTRFLRNYTLGEPGILEGSMRGSKRLLLMVSSVSFLALMPMVIPDTSMAIGLSNIAFQ
SMVYVLLEDISLGSLKDSKGLPGATVDLKSLASSGYLRAAVGATGGFLLLATYFEKSLRD
YTAPQWAGFNLAKITCMGMLGGLRWLCMPILVSRLSSPSGSMIDLSITLIASQLVMWTSP
FQLFGTIAALILASFHFVGLPNNREILPQRFGPTRAIIGTFFILLIFFSVFISVVPRTPA
VSSQPTAPPPHIHPIAHLMEHSLNEFEAMKQRQSTSLRDAVRNYKKRYGMAPPPNFDKWY
EFAVSRKSLLVDEYDTIFHQIQPFWGMPPKMIRERAREALGFPQALLRLSLRNGAVIDTS
DGEEWQRTATVGMIENFRQWLPDMDLAFNTHDEPRVVVPTEEMSTLVSRAKSMEFVGTPM
NTFTGFPKDEQGPVKDTDDTRFNEFAHQSIWGNSKLSCPPGTPARDPLEGTPDALEKYTM
VPIPFITNRTASTDVCLQPSVRRRHGFFQRPNAYHVSHNLFPVFSQSKVSCYNDLVYPSP
WYWAGKVSYDETQDMSWDQKKDILFWRGSTTGGFSRRGGWRHQHRQRVVMHLNAFNETSQ
VFEMENNDKKTIWRVKSAERETLKSLIDVHFSHIGQCDEEDCKEQEAFFKPAEAVDQQYV
WNHKYLLDIDGNAFSGRFYAFLLSNSAVFKMALFREWHEDWLVPWVHYVPLSLDMAESSE
VLRYFTAEKEGKEGIKKVASQGRSWAKKVLRKEDFEVWFFRLLLEFGRVIDDNRDKIGFD
I

Enzyme Prediction     

No EC number prediction in RVD88596.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	626	889	3.6e-75	0.948

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	9.24e-22	614	888	4	251	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	3.49e-07	619	888	92	321	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGX43365.1|GT90	0.0	1	883	1	883
UJO10778.1|GT90	3.48e-203	31	899	26	956
BCR83603.1|GT90	6.36e-200	356	899	28	598
UKZ85843.1|GT90	6.81e-199	359	901	79	629
UKZ59411.1|GT90	9.95e-199	359	901	80	630

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	1.69e-08	642	900	118	353	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]
5F84_A	1.09e-07	642	890	154	379	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	1.87e-49	373	896	152	662	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q16QY8|RUMI_AEDAE	6.28e-09	635	890	156	388	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|B0X1Q4|RUMI_CULQU	1.11e-08	634	896	156	397	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q6UW63|PLGT2_HUMAN	5.80e-08	725	889	299	466	Protein O-glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=POGLUT2 PE=1 SV=1
sp|Q8NBL1|PGLT1_HUMAN	1.01e-07	642	900	146	381	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999874	0.000138

TMHMM  Annotations     

Start	End
40	62
148	165
215	234
246	268
298	320
333	355