CAZyme Information: RVD88269.1

Basic Information

• Species: Arthrobotrys flagrans
• Lineage: Ascomycota; Orbiliomycetes; ; Orbiliaceae; Arthrobotrys; Arthrobotrys flagrans
• CAZyme ID: RVD88269.1
• CAZy Family: GH95
• CAZyme Description: Glyco_hydro_3 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A437AAH8]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1008		110279.69	7.5003

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflagransCBSH-5679	9927	N/A	30	9897

• Gene Location: location=SAEB01000003:3705350-3708879(-)

Full Sequence      

MDENDRLSWDIGAVFMMGFSGTAVTPQVKQLIEENHIGTIMLSGKNFKSAEQATKLILEL
QTIARNANHQHPLLIAIDQENGGLNNLCDTLHIRQFPGAMGMAATGSPELCREVAKATAL
EVSSVGVNWVLGPVLDVLNPNARTQPLGVRTMGHEPEEVSEMGVAFMRGLQDGGVAACAK
HFPSYGNIEFQGSPLDVPILSDTIEQLKLHGLIPFRKAVAADIDAVMVGGCSMPSLGTKV
MHACLSDTVINKLLREEMGFKGVVVSECLEMEALHENIGVGQATVMALDAGCDQIIVCRS
FTLQQEAIQGLQIAVDSTIISREMVAEAAARVSVMKQKRTSWQQALNPPGVDYLSILEPS
HKELSVRAYEASITIVRDENRLLPLPTRPKEGHDILLLTPLVKPLPASLLAQAEELNAAL
KLESSRSDSSPTPTTGTSSVASRPDHKSLLSSFLSDKDRVLMTGEVVFRELGRSIGRSSG
ARILHSSYTASGIRPVHENLIEAASMIIVVTADANQNRYQYGFTKHISAITKIPTDRFPK
GKQVLVIAVSSPYDFWLDKSIGTYVCTYDFTETAIDALVKVIFGKKNAKGLLPGTIFKRR
RQQQQPKQQWLVEHWKKTRDLESLKQLIEAVRRGSSETPSLYIDLATLPAAAYLTEDIIM
NDGSVILEQQNFVVRNSSTRALYGFCSTYYNPRSGVGSIGIIVVDPARRKLSIGNSLHAS
ALRYLRQKKGIKRVSIGSRFPAAYLGMPASLNPNITMVNLTEGMDATKSFKTWFRNLGWP
ETSSSRVYRLLLSNLSEWKPPTTISKQLSESAISFELISDAKTTAAPLLYEQTMEFVRSN
DNGRYIDPYRIAGDDLQISQARILIATNTQKQFLGTVILVWGSSDLGKLEKFTPLIRPNM
LASAAGNVGIESDKGPRNVCGIIYPVLAPTPLRRLVLEGLVAISTKHFQMPQQQGMAGFG
KVILDCLDNPEDAQAIITNGNGAQGAGGWQVWHTFEEVECSLLELRSS

Enzyme Prediction     

No EC number prediction in RVD88269.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	65	296	8.6e-57	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	1.54e-70	14	403	7	365	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	8.35e-58	11	332	6	313	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	1.42e-36	16	346	5	326	beta-hexosaminidase; Provisional
185053	PRK15098	1.13e-09	72	293	105	316	beta-glucosidase BglX.
178629	PLN03080	2.04e-09	96	385	114	415	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGX43696.1|GH3	0.0	1	1008	1	1004
QMW48185.1|GH3	1.95e-283	5	1000	13	921
QMW36125.1|GH3	1.95e-283	5	1000	13	921
UDD65351.1|GH3	1.95e-283	5	1000	13	921
BAE65506.1|GH3	5.14e-283	5	1000	42	950

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	2.92e-81	3	823	5	721	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	1.49e-59	7	596	13	531	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	6.48e-42	22	400	71	460	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	8.55e-42	22	400	45	434	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	1.24e-41	22	400	75	464	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	3.33e-41	22	400	71	460	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|B2FPW9|NAGZ_STRMK	3.06e-32	14	312	1	291	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=nagZ PE=3 SV=1
sp|B4SRK3|NAGZ_STRM5	4.14e-32	14	312	1	291	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain R551-3) OX=391008 GN=nagZ PE=3 SV=1
sp|Q7WUL3|NAG3_CELFI	5.76e-32	1	385	26	398	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
sp|Q5QUZ5|NAGZ_IDILO	9.24e-32	13	345	2	326	Beta-hexosaminidase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) OX=283942 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000000

TMHMM  Annotations     

There is no transmembrane helices in RVD88269.1.