CAZyme Information: RVD88155.1

Basic Information

• Species: Arthrobotrys flagrans
• Lineage: Ascomycota; Orbiliomycetes; ; Orbiliaceae; Arthrobotrys; Arthrobotrys flagrans
• CAZyme ID: RVD88155.1
• CAZy Family: GH81
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
308		35938.71	7.9738

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflagransCBSH-5679	9927	N/A	30	9897

• Gene Location: location=SAEB01000003:3349733-3350910(+)

Full Sequence      

MRRAFVYFLIAVAIGLAYGVYTTSTLISLLFEDVSQDLIPKVEIELEAAEEFAKRPALVP
KIIHQTYKTADIPDRWKAPQKLCLDLHPDWEYKLWTDDSAREFIAKEYPWFLQTFDDYDH
PIMRADVIRYFALRKFGGIYIDLDVGCRRKLDPLLAYPAVARKTDPTGISNDVMVAIPEH
KFFVHVTEVLQSYNRHWVMPYITIMASTGPLFLSIIWKKWTGMKLDNMDRVRILMASEQQ
HNDWSFFRVYKGSSWHTQDAQTIFWMRQHVPHLVIGGVLLAGILGYTVYWVIHRPRGYAK
VDKGIYDA

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	76	155	2.8e-22	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.14e-60	57	286	80	311	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	8.87e-24	73	161	1	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGX43822.1|GT32	1.81e-219	1	308	1	308
BCR89010.1|GT32	8.59e-115	1	301	1	309
APA07946.1|GT32	6.84e-114	1	300	1	305
CAK42232.1|GT32	1.45e-113	1	294	1	294
BCS14035.1|GT32	2.05e-113	1	294	1	294

PDB Hits     

RVD88155.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33300|SUR1_YEAST	3.95e-93	1	286	1	282	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	3.21e-85	20	295	20	303	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	1.18e-80	40	289	64	315	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|Q10323|IMT3_SCHPO	3.28e-80	16	303	16	300	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	1.86e-47	59	307	64	316	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.805645	0.194360

TMHMM  Annotations     

Start	End
5	27
197	216
270	292