CAZyme Information: RVD87657.1

Basic Information

• Species: Arthrobotrys flagrans
• Lineage: Ascomycota; Orbiliomycetes; ; Orbiliaceae; Arthrobotrys; Arthrobotrys flagrans
• CAZyme ID: RVD87657.1
• CAZy Family: GH72
• CAZyme Description: Glyco_trans_2-like domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A437A9S7]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
880	SAEB01000003|CGC2	98926.82	5.8376

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflagransCBSH-5679	9927	N/A	30	9897

• Gene Location: location=SAEB01000003:1691028-1694144(+)

Full Sequence      

MGLKNYFKAPPAPNAGAPEGSSPPQSEKGPAMTPAVGGSLEMPGLRSPSRVSSSRSSLNS
PGSSRSSALIEDIKHEVMVNYLFQQQCSQMWVADVTGEAEGVILRKSRNNYMACPPELGR
SRFAAACAAMNVQVAMTVNSRVIKTFLQWSPDALDVPLMNGLRIQILPTIDDLPRAKKHQ
FAAFIAHEQILVVWDDDALHIVQRAKSIESELMELVWRTHEDIEADNEKKDPNHAHVEEL
DEESGEITLESRPTHLMNTVLVSLTLILVIVTLGAGYRQLAVEIAVDGDFTRLAFLALTP
VQIFLTLFFGQVIVGCIAQVFGPVRQLSMNSKFYSAKPPVRIRTPSLPHVTIQCPVYKEG
LHAVIAPTIKSIKQAISTYELQGGSANIFINDDGLQLIEEEDRQARIEFYADNNIGWVAR
PKHGENGFLRRGKFKKASNMNFALMISCKVEEKLAAIERTEDWTQHDEAQAYEEALKEVV
TTDGRAWADGNIRVGDYIILIDSDTRVPADCLLDAVSELERSPEVGIMQYSSGVMQVVHN
YFENGITFFTNLIYTAIRYTVSNGDVAPFVGHNAILRWSAVQQVSYMDEDGYEKFWSESH
VSEDFDMSLRLQVNGYTIRLAAYTGDGFQEGVSLTVYDELARWEKYAYGCNELLFHPIRF
WLIRGPFTPLFRRFLFSNIRMTSKITIISYIGTYYAIGAAWIMTTANYFAIGWFNGYLDK
YYIDSWRVWFSIVIVFNGLGNIALAVMRYRIGERTFLYALFENFKWVPMLALFLGGLSLH
VSQALLAHMFEIDMTWGATGKEVEYSNFFIEVPKVLKRFKWSMIFALLAIAGVVILAVAP
FVPYSYRITDFTPILPMCTVAVSHLLFPLALNPALMTFSF

Enzyme Prediction     

No EC number prediction in RVD87657.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	497	702	1.1e-50	0.9898477157360406

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	2.61e-51	497	703	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
224136	BcsA	9.73e-15	495	789	138	422	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	1.57e-10	355	590	4	175	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
224137	GT2	3.33e-09	494	675	84	280	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
133043	CESA_CelA_like	1.35e-06	348	619	1	201	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGX47761.1|GT0	0.0	1	880	1	879
UNI13811.1|GT0	0.0	1	879	1	890
QLI69301.1|GT0	0.0	1	879	1	893
QUC18054.1|GT0	0.0	1	879	1	892
AEO64878.1|GT0	0.0	1	879	1	891

PDB Hits     

RVD87657.1 has no PDB hit.

Swiss-Prot Hits     

RVD87657.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000006

TMHMM  Annotations     

Start	End
260	282
302	324
690	712
727	749
770	792
824	846
853	875