CAZyme Information: RVD87164.1

Basic Information

• Species: Arthrobotrys flagrans
• Lineage: Ascomycota; Orbiliomycetes; ; Orbiliaceae; Arthrobotrys; Arthrobotrys flagrans
• CAZyme ID: RVD87164.1
• CAZy Family: GH55
• CAZyme Description: CBM1 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A437A7J7]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
401		41701.97	7.3403

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflagransCBSH-5679	9927	N/A	30	9897

• Gene Location: location=SAEB01000006:8233027-8234520(-)

Full Sequence      

MRPELQISLALAFATQAIAQAQPWGQCGGNGWTGPTSCVSGWCCQASNEWYSQCIEGSCG
GGSTTTTTTRTTTTSSRTTTLATTTRTTTSSAANPTTSSSGGTCSGSSATVNQLQGYGTG
TTGGGSGSGTTVTSCSALEAALSGTTGGVIRISGLLNGCGTYRVPSDTTIVGVGSNSGMV
GGGLYVRRVSNVIIRNLKLSPPAKGDAVNIDGSTRVWVDHCEFYSLGLVGGKDDFDGLLD
VSHGSDFVTISWNKFRDHWKGSLVGHSDNNAGEDTGKLHVTYHHNSFTNVNSRLPSVRFG
TAHIFSNCYTNIPTSGINSRMGAQVLVEQNHFRNTKLAIVTNLDSDYDGYAVHRNNIFDS
SDIRITQAGSLSSPPYSYTASPACRVCDLITASAGTGVISV

Enzyme Prediction     

No EC number prediction in RVD87164.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	156	334	3.7e-96	0.9835164835164835

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	1.50e-65	156	336	6	190	Amb_all domain.
226384	PelB	7.29e-61	143	399	72	344	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	1.37e-44	164	332	32	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.
395595	CBM_1	8.16e-14	23	51	1	29	Fungal cellulose binding domain.
197593	fCBD	4.45e-13	23	55	2	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGX51798.1|CBM1|PL1	3.92e-203	1	401	1	401
EGX44937.1|PL1_9	3.81e-132	109	400	117	406
UPK93374.1|PL1_9	1.45e-116	108	400	151	440
QRC97218.1|PL1_9	2.03e-114	108	400	25	314
QPC60518.1|PL1_9	6.41e-112	103	400	108	404

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VMV_A	3.04e-44	167	400	80	326	Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 [Bacillus sp. N16-5],3VMW_A Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 in complex with trigalacturonate [Bacillus sp. N16-5]
1PCL_A	9.67e-36	164	309	78	246	Chain A, PECTATE LYASE E [Dickeya chrysanthemi]
1VBL_A	2.57e-32	164	332	130	330	Structure of the thermostable pectate lyase PL 47 [Bacillus sp. TS-47]
3ZSC_A	1.31e-31	163	321	65	225	Catalytic function and substrate recognition of the pectate lyase from Thermotoga maritima [Thermotoga maritima]
2QY1_A	5.48e-31	116	397	4	325	Chain A, Pectate lyase II [Xanthomonas campestris pv. campestris],2QY1_B Chain B, Pectate lyase II [Xanthomonas campestris pv. campestris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CBV0|PLYB_ASPTN	2.04e-69	120	396	45	320	Probable pectate lyase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyB PE=3 SV=1
sp|Q00645|PLYB_EMENI	5.68e-66	120	395	46	323	Pectate lyase plyB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyB PE=1 SV=1
sp|B8NBC2|PLYB_ASPFN	2.24e-65	120	352	46	278	Probable pectate lyase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyB PE=3 SV=1
sp|Q2TZY0|PLYB_ASPOR	2.24e-65	120	352	46	278	Probable pectate lyase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyB PE=3 SV=1
sp|O59939|PLYB_COLGL	4.42e-63	116	395	48	326	Pectate lyase B OS=Colletotrichum gloeosporioides OX=474922 GN=PLB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000349	0.999633	CS pos: 21-22. Pr: 0.8747

TMHMM  Annotations     

There is no transmembrane helices in RVD87164.1.