CAZyme Information: RVD86084.1

Basic Information

• Species: Arthrobotrys flagrans
• Lineage: Ascomycota; Orbiliomycetes; ; Orbiliaceae; Arthrobotrys; Arthrobotrys flagrans
• CAZyme ID: RVD86084.1
• CAZy Family: GH43
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
615		69257.29	5.3048

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflagransCBSH-5679	9927	N/A	30	9897

• Gene Location: location=SAEB01000006:4613255-4615166(+)

Full Sequence      

MDVGISRLFSMFGRCWFKYYHYDDYRPIYDVSYKYLYKNFKIFDSLVDNYNRVNDHDHAA
VEYYHYSKLNHYCSDNDKPYSNFFCGWNIGNTLDAIPNEGSWNNPPITGTVIDAIKASGY
KSIRIPVTWTHHFSGSSPTWTVDPVWMNRVEEVVDMVLGKGLYAILNVHHDSFDWFDYTK
NGNAAVEEKFGALWAQIGDRFKCKGERLLFEPINEPPGSTAEDGAELNKLNDIFLTKINQ
AGGFNPQRVVTLCGLNMDSYKTISYFQRGTLYPNQPWGLQFHYYSPYDFVFRAWGKSTWG
SADEKATLDNDFKYFRGNFSDVPVVIGEFGGSPATLEPAAGWRYFDYLIQTANKYQFAIV
AWDNGEDLFNRTSLTWYDPAGQSILINAASGASNALAVSTLDGSEPQLSSAFIFHKFGTP
VTTQTATYENVGSKALVSVKNKAGTALTSSQYSFSGGVLTLSDTYLSTLYTANSAPGVKE
VLTLTFSSGAFLTLTIVHWDVPVISETTLTAPTYDYRIPITWNGYNRVAAVRAVWDNGVY
VSDDWTVWLPPLQQARWTFGNWGYEANNVALWLSGSDYLRNNKPAGVNSAILTWEFFPRD
GYTAGSNAVNLTITF

Enzyme Prediction     

EC	3.2.1.-:12	3.2.1.4:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	99	365	8.9e-74	0.9891304347826086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	4.21e-33	93	365	10	269	Cellulase (glycosyl hydrolase family 5).
225344	BglC	1.83e-16	86	331	54	323	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
397483	CBM_X2	1.30e-09	409	496	3	83	Carbohydrate binding domain X2. This domain binds to cellulose and to bacterial cell walls. It is found in glycosyl hydrolases and in scaffolding proteins of cellulosomes (multiprotein glycosyl hydrolase complexes). In the cellulosome it may aid cellulose degradation by anchoring the cellulosome to the bacterial cell wall and by binding it to its substrate. This domain has an Ig-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGX48303.1|CBM1|GH5_4	0.0	86	615	150	679
APA10925.1|CBM1|GH5_4	7.47e-184	86	614	122	650
ATZ52514.1|CBM1|GH5_4	1.37e-183	86	614	131	658
CCD46753.1|CBM1|GH5_4	1.94e-183	86	614	131	658
QSZ37319.1|CBM1|GH5_4	6.31e-182	86	614	139	669

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YZP_A	1.02e-93	86	591	34	530	Crystal structure of a tri-modular GH5 (subfamily 4) endo-beta-1, 4-glucanase from Bacillus licheniformis [Bacillus licheniformis],4YZT_A Crystal structure of a tri-modular GH5 (subfamily 4) endo-beta-1, 4-glucanase from Bacillus licheniformis complexed with cellotetraose [Bacillus licheniformis]
5E0C_A	1.43e-54	86	546	20	477	Structural Insight of a Trimodular Halophilic Cellulase with a Family 46 Carbohydrate-Binding Module [Bacillus sp. BG-CS10]
5XRC_A	3.42e-54	86	546	53	510	A Trimodular GH5_4 Subfamily Endoglucanase Structure with Large Unit Cell [Bacillus sp. BG-CS10],5XRC_B A Trimodular GH5_4 Subfamily Endoglucanase Structure with Large Unit Cell [Bacillus sp. BG-CS10],5XRC_C A Trimodular GH5_4 Subfamily Endoglucanase Structure with Large Unit Cell [Bacillus sp. BG-CS10]
6PZ7_A	3.58e-53	86	387	19	335	GH5-4 broad specificity endoglucanase from Clostridium acetobutylicum [Clostridium acetobutylicum ATCC 824]
5E09_A	1.83e-52	86	546	20	477	Structural Insight of a Trimodular Halophilic Cellulase with a Family 46 Carbohydrate-Binding Module [Bacillus sp. BG-CS10]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23550|GUNB_PAELA	3.46e-54	86	538	47	496	Endoglucanase B OS=Paenibacillus lautus OX=1401 GN=celB PE=3 SV=1
sp|P28623|GUND_CLOC7	1.35e-47	86	393	53	376	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2
sp|O08342|GUNA_PAEBA	4.51e-47	86	388	50	394	Endoglucanase A OS=Paenibacillus barcinonensis OX=198119 GN=celA PE=1 SV=1
sp|P28621|GUNB_CLOC7	2.69e-45	86	389	52	374	Endoglucanase B OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engB PE=3 SV=1
sp|P10477|CELE_ACET2	4.12e-44	86	389	67	385	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000073	0.000000

TMHMM  Annotations     

There is no transmembrane helices in RVD86084.1.