CAZyme Information: RVD86069.1

Basic Information

• Species: Arthrobotrys flagrans
• Lineage: Ascomycota; Orbiliomycetes; ; Orbiliaceae; Arthrobotrys; Arthrobotrys flagrans
• CAZyme ID: RVD86069.1
• CAZy Family: GH37
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
330		36383.15	6.5939

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflagransCBSH-5679	9927	N/A	30	9897

• Gene Location: location=SAEB01000006:4553828-4554820(+)

Full Sequence      

MSRPYMVPEKIPEIHFVDHDDTVDVETQGEQRSLLYSPNRGEIKHRHAVPHRKLIVVIVA
LLLKSVVATIGALKMRCGGEHAGDDVRHVDHIPSVFKRIAVPPGWESKSNDLTEVETTTK
RIAVPSGWYEKSDDLKEVETTADVTKRMAVPAGSKETTDEGNLFERDFTFKRPGSLLSST
RTTVPEVVIQSQLPKKLKSFANAEVFGYVHQSYGKRPVAEAQADLLAYAAWKAPKIGISL
DGIFFDESLDTAANTPYVATANTFAKAQGLSTTIQNAKTVPSREYFASTQNTDITVVLED
SFDDYNTIAAKYDGLAAKYGVSKSAFSFII

Enzyme Prediction     

No EC number prediction in RVD86069.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH135	195	316	1.3e-24	0.5232067510548524

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403383	Spherulin4	1.26e-37	173	330	34	187	Spherulation-specific family 4. This protein is found in bacteria, archaea and eukaryotes. Proteins in this family are typically between 250 and 398 amino acids in length. There is a conserved NPG sequence motif and there are two completely conserved G residues that may be functionally important. Starvation will often induce spherulation - the production of spores - and this process may involve DNA-methylation. Changes in the methylation of spherulin4 are associated with the formation of spherules, but these changes are probably transient. Methylation of the gene accompanies its transcriptional activation, and spherulin4 mRNA is only detectable in late spherulating cultures and mature spherules. It is a spherulation-specific protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDS69384.1|GH135	6.68e-14	195	306	114	229
EKD13473.1|GH135	1.95e-11	196	330	104	238
BCS28305.1|GH135	1.54e-10	182	307	175	303
EAW24740.1|GH135	1.00e-09	195	330	101	237
BCS14736.1|GH135	1.36e-09	195	330	102	237

PDB Hits     

RVD86069.1 has no PDB hit.

Swiss-Prot Hits     

RVD86069.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999851	0.000162

TMHMM  Annotations     

Start	End
54	73