CAZyme Information: RVD85929.1

Basic Information

• Species: Arthrobotrys flagrans
• Lineage: Ascomycota; Orbiliomycetes; ; Orbiliaceae; Arthrobotrys; Arthrobotrys flagrans
• CAZyme ID: RVD85929.1
• CAZy Family: GH31
• CAZyme Description: alpha-1,2-Mannosidase [Source:UniProtKB/TrEMBL;Acc:A0A437A4B1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1104	SAEB01000006|CGC15	124439.96	6.8466

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflagransCBSH-5679	9927	N/A	30	9897

• Gene Location: location=SAEB01000006:4043771-4047520(-)

Full Sequence      

MFKCKQATPSSQAPTSTHELTDTVFHPSMKLDVLSNTLVPLGIIGIQLCLCMSESHITNL
RHEAMEMFHHGFESYMNFAYPADEIRPLSCIALDRDHEPNNSGMTDVLGNYSLTAIDSLS
ALGILSVSSPRSYTWFWDTVQRISRTYWGHGFDRDSKVQVFETVIRGVGGLISGHQFAIG
MLPIPGKPGYSHKGWKYNDELLHLAHDLATRLLPAFTTDTGLPYPRVNLRYGCVNVRPPP
VDTEHGEEPAEKCRKDEEEAERAGFKPLRNERTETCAAGAGSLTLELTTLTRLLQHYKTH
FPERVKIFLKTTPHMKHRWDDVEIFERVSQQAFWAVWERRSSLNLVGGGLDAVTGKWEPQ
SGSLAGIGASTDSFFEYAMKTYILLSSSPTVPDAKNPNPRLPHEYLDVFEKSVAAINKYM
LVESPAFFYQGVHMATGEPMVQWVDSLSAFWPGLLVLAGDVATAERACLFYTALWQRYQA
LPERYVPAKQSIQLHWWPGRPEFAESVYHLYRATKDVWYLRVGEMILRDIQRRCWGRCGW
GGIEDVKSGKVSDRMESFLLSETAAYLYLLFDDAHPLHRGDLPWVFTTEGHPIIMPKGRT
YKQNEMLWREDRPKRDGKSREDEETCENTKVSNPNVKVGELFSRTASRTDTFHPYNAVGL
NLLPDNVPRAPTTLVFLNRENVPEEFGYYNDKDEENPYRFITPYSPTNGSFYPWTLPPQL
IAPLSYCAKLPGENKLDLVFSVIPVKIGETPPPSWIDIKGGVLINSLSGLRIGFSRELIE
GRIEYFITKIGDRLIRQDEIVVIEKINIDSLQVDGQARFRTLKDEGYEVVFDFETEQKPP
PPSPTPTTAKEGLKDKKVEIKMDGKDLDGDILKRVEEILWDSFKNQIYEKAAPTPRRTLT
PKLTSKGKAVVRRHLHAILSSGIGAQETPPITLKTHAFLKSMEYTPSPTLPWRSVYVAGL
GCDSPLPSIAATYPIILFKRGKCPFSHKMNNLPTSSGIKLAIVVNFDDTVVSHKLYEEVV
DLDNGGGVNDWAGLRDDYLIRPLLDKYQVDSRNGQRRKNPIPLVFVGGGEATYAALGEAR
GVGLRERWKVSLDGVVVGNLVPVV

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	324	593	7.7e-70	0.6188340807174888
GH47	67	296	9.1e-46	0.36995515695067266

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	4.83e-97	67	593	1	451	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	3.46e-39	61	597	73	520	glycoside hydrolase family 47 protein; Provisional
239045	PA_ScAPY_like	1.63e-05	940	1008	12	79	PA_ScAPY_like: Protease-associated domain containing proteins like Saccharomyces cerevisiae aminopeptidase Y (ScAPY). This group contains various PA domain-containing proteins similar to the S. cerevisiae APY, including Trichophyton rubrum leucine aminopeptidase 1(LAP1). Proteins in this group belong to the peptidase M28 family. ScAPY hydrolyzes amino acid-4-methylcoumaryl-7-amides (MCAs). ScAPY more rapidly hydrolyzes dipeptidyl-MCAs. Hydrolysis of amino acid-MCAs or dipeptides is stimulated by Co2+ while the hydrolysis of dipeptidyl-MCAs, tripeptides, and longer peptides is inhibited by Co2+. ScAPY is vacuolar and is activated by proteolytic processing. LAP1 is a secreted leucine aminopeptidase. The significance of the PA domain to these proteins has not been ascertained. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGX51762.1|GH47	0.0	104	1104	1	1001
QDS72860.1|GH47	8.46e-193	51	1103	34	1055
CBX91276.1|GH47	2.26e-189	48	1101	28	1055
QSS56460.1|GH47	3.05e-187	46	1103	38	1125
QSS71303.1|GH47	3.05e-187	46	1103	38	1125

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KIJ_A	3.81e-19	56	593	1	449	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	3.99e-19	56	593	6	454	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	4.05e-19	56	593	6	454	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
1X9D_A	6.48e-19	56	593	84	532	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]
5KK7_A	1.63e-18	56	593	1	449	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94726|MNL1_SCHPO	4.76e-107	52	591	27	473	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mnl1 PE=3 SV=2
sp|Q925U4|EDEM1_MOUSE	2.27e-89	58	610	123	592	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Mus musculus OX=10090 GN=Edem1 PE=1 SV=1
sp|Q92611|EDEM1_HUMAN	4.90e-89	58	610	128	597	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Homo sapiens OX=9606 GN=EDEM1 PE=1 SV=1
sp|Q9SXC9|MNS5_ARATH	6.63e-79	53	593	26	476	Alpha-mannosidase I MNS5 OS=Arabidopsis thaliana OX=3702 GN=MNS5 PE=1 SV=1
sp|P38888|MNL1_YEAST	3.38e-78	61	604	36	513	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNL1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000034	0.000031

TMHMM  Annotations     

There is no transmembrane helices in RVD85929.1.