CAZyme Information: RVD85793.1

Basic Information

• Species: Arthrobotrys flagrans
• Lineage: Ascomycota; Orbiliomycetes; ; Orbiliaceae; Arthrobotrys; Arthrobotrys flagrans
• CAZyme ID: RVD85793.1
• CAZy Family: GH3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
488	SAEB01000006|CGC37	55928.44	5.6165

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflagransCBSH-5679	9927	N/A	30	9897

• Gene Location: location=SAEB01000006:3585420-3586953(+)

Full Sequence      

MADLKPHLKGALRPDFQWGYATAAAQIEGAWNADGRGESIWDRLGHTPGKIKDSSTADDA
CRSYDFYKEDVALMKSYGVTAYRFSLSWSRIIPLGGKDGPVNPKGIEFYNNLINELLANG
ITPFVTLFHWDIPQALEDRYGGMLNLEKYTPDFLRYARVCFESFGDRVKNWITYNEPGVY
SLAGYAAGVHAPGRSSNRELNEEGDSSTEPFIVSHTELVSHAHCVKMYREEFKPTQKGTI
MITLHGNYSEPWDEEDPLDIEAAERAREFEIAWFADPIYKTGDYPASMRAQLGDRLPRFT
EEESKLLLGSSDFYGMNTYTTFYVKHKKTPPELTDHLGNVEKLDNNSKGVSRGAESDTYW
LRTCPWGYRKLLNWVWNRYHVPIFMTENGTTAKGEHLDTPPTDPLNDTHRIEFFNGYLNA
LASAVKEDGVDIRSYFAWTFTDNWEWAAGYTDRFGVTWIDYKSPEKRRYPKKSAGVIREH
FEHYIAKE

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	10	482	1.6e-154	0.9836829836829837

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395176	Glyco_hydro_1	4.67e-164	8	474	1	441	Glycosyl hydrolase family 1.
225343	BglB	1.70e-131	15	479	7	448	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215435	PLN02814	1.52e-119	15	474	31	473	beta-glucosidase
215455	PLN02849	4.10e-114	16	474	34	473	beta-glucosidase
215539	PLN02998	5.68e-104	14	474	33	478	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGX51900.1|GH1	0.0	1	488	1	488
CCD55258.1|GH1	3.93e-298	8	485	10	485
ATZ52175.1|GH1	3.93e-298	8	485	10	485
CAP91982.1|GH1	1.63e-283	8	485	9	485
QQK46886.1|GH1	1.61e-281	8	485	9	485

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MDO_A	5.15e-186	11	488	25	499	Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea],4MDP_A Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea]
6EFU_A	3.57e-178	12	488	3	466	Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],6EFU_B Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
5BWF_A	4.86e-178	2	488	12	485	Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],5BWF_B Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
5JBK_A	7.18e-178	12	488	3	466	Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum],5JBK_B Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum]
5JBO_A	1.38e-172	11	481	7	475	Trichoderma harzianum GH1 beta-glucosidase ThBgl2 [Trichoderma harzianum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q25BW4|BGL1B_PHACH	1.30e-170	12	486	11	476	Beta-glucosidase 1B OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1B PE=1 SV=1
sp|Q25BW5|BGL1A_PHACH	5.60e-163	12	485	6	460	Beta-glucosidase 1A OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1A PE=1 SV=1
sp|Q8L7J2|BGL06_ORYSJ	8.82e-143	9	473	47	511	Beta-glucosidase 6 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU6 PE=1 SV=1
sp|Q339X2|BGL34_ORYSJ	5.66e-141	16	473	42	498	Beta-glucosidase 34 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU34 PE=2 SV=1
sp|Q9FZE0|BGL40_ARATH	1.82e-139	9	473	34	498	Beta-glucosidase 40 OS=Arabidopsis thaliana OX=3702 GN=BGLU40 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000000

TMHMM  Annotations     

There is no transmembrane helices in RVD85793.1.