CAZyme Information: RVD85447.1

Basic Information

• Species: Arthrobotrys flagrans
• Lineage: Ascomycota; Orbiliomycetes; ; Orbiliaceae; Arthrobotrys; Arthrobotrys flagrans
• CAZyme ID: RVD85447.1
• CAZy Family: GH28
• CAZyme Description: Mannan endo-1,6-alpha-mannosidase [Source:UniProtKB/TrEMBL;Acc:A0A437A2X6]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
465	SAEB01000006|CGC6	50166.99	4.6788

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflagransCBSH-5679	9927	N/A	30	9897

• Gene Location: location=SAEB01000006:2445875-2447468(+)

Full Sequence      

MRSLLSISSAVLALSLAPAVLGQLKIDVDKPDTLKAAAKVVVKSLVDDYTSQKPFVAGIL
PSEYSFFESGVFFNTILNYAAFTGDATYNSLFEKDFFNQIGDNANFIPSNKSARIANDDV
GYWALAAISAAEFGAKPSDSSSPSYLTLAENVFNDFVQRWDDKTCGGGLRWAVQASSTGY
DFKDTNSNGVFFELAARLGVQTGNKTYLDWANKVYDWTVKVGLIGSLDTNNVGQVYAGAS
VQDKCQQVDQSHYSAQQANYIYGAAVMYATIKSPTWRNRLNSLVQYTSVTYFGPQQYVDD
GRSQVVTEAGCEYDNKCTTDQKAGKSILFRSLAFALVYDNMYSYFKVQITNSARAAAKSC
NSAGDCGFDWSDLKYDATAGTGVGEKMAAIESFLAVVRHLDAKPVKGVFEAEEQTESPSE
IETSSPASQTSTAPEVSQTPNSGSRLAVGGVLGGAVIASLLHMLL

Enzyme Prediction     

EC	3.2.1.101:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	33	399	7.5e-67	0.9273743016759777

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	2.03e-105	33	389	1	347	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	1.31e-05	118	221	93	181	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGX52473.1|GH76	8.60e-265	1	465	1	465
QDS74119.1|GH76	2.47e-79	32	405	22	398
UKZ91066.1|GH76	5.53e-79	12	397	6	384
UKZ48633.1|GH76	1.89e-76	12	403	5	393
UKZ75168.1|GH76	7.42e-76	12	403	5	393

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	2.06e-48	25	394	29	403	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36091|DCW1_YEAST	4.60e-64	25	391	23	379	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q6FLP9|DCW1_CANGA	9.47e-62	24	391	19	376	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|O74556|YCZ2_SCHPO	7.61e-58	7	395	7	382	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q5AD78|DCW1_CANAL	1.96e-56	26	404	21	395	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1
sp|Q75DG6|DCW1_ASHGO	1.53e-53	9	391	7	381	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000222	0.999759	CS pos: 22-23. Pr: 0.9754

TMHMM  Annotations     

There is no transmembrane helices in RVD85447.1.