CAZyme Information: RVD85381.1

Basic Information

• Species: Arthrobotrys flagrans
• Lineage: Ascomycota; Orbiliomycetes; ; Orbiliaceae; Arthrobotrys; Arthrobotrys flagrans
• CAZyme ID: RVD85381.1
• CAZy Family: GH27
• CAZyme Description: alpha-1,2-Mannosidase [Source:UniProtKB/TrEMBL;Acc:A0A437A2N5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
541	SAEB01000006|CGC21	61366.71	6.5782

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflagransCBSH-5679	9927	N/A	30	9897

• Gene Location: location=SAEB01000006:2100166-2101990(+)

Full Sequence      

MSGLPRRSRVLLMGLILFIIGSTMYLKSEKLTAVTSIRTYFPHSGIQLEHGEIKFRADAI
KEAYQHSWNGYMQFGFPKDELLPISKQGGNSMSGWGASVIDGIGTAILMELPEVVEQQLR
FISEIDYTQCEHQINLFETTIRYLGGMISAYDLLTGPYSQFIQGGKGQKNHDLVSSLLKQ
SVTLADALKWSFNTTSGIPMPFFMLNSKKIKSDDINSIAGFGTLVLEWTRLSDLTGDPQY
TNMAQRAQEYLLKVENPEIGEPFPGLLGTNVRLNDGKFLDSYGGWGAMGDSYYEYLIKMY
AYDPQRFRRYMNRWIQAADSTMTYLTSVPDTTPPSNLIFVGEYSHSHSIALRGSHLACFI
GGNFLLGGQILGNVKYNIYGLQLVEGCRTTYANSPSGIGPERFGWDPNLVPSNQKEFFNK
NGWYYGGEIDYRLRPEVIESYYHAWVVTQDDIYRQWAWEAFVAINRTCRTEHGFTAVSDV
SRKDGGKKDDKQESFWFAEVLKYLFLIFNEEGIQAKEKVGFVAGSKQKWVFNTEAHPIRI
Y

Enzyme Prediction     

EC	3.2.1.113:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	64	540	1.4e-128	0.9955156950672646

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	1.79e-174	63	540	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	1.31e-105	54	540	70	518	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGX52392.1|GH47	0.0	1	541	1	541
BCS18383.1|GH47	7.71e-168	56	541	26	495
BCR86649.1|GH47	7.63e-166	50	541	24	499
BAA08275.1|GH47|3.2.1.113	1.11e-165	56	540	40	508
ABA54911.1|GH47	6.65e-164	30	541	19	515

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2RI8_A	1.13e-167	56	540	5	473	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
1KKT_A	3.82e-167	56	540	40	508	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
1HCU_A	5.08e-133	56	540	15	492	Chain A, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_B Chain B, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_C Chain C, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_D Chain D, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei]
5KKB_A	3.89e-61	53	540	19	467	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]
1NXC_A	4.79e-61	53	540	17	465	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P31723|MAN12_PENCI	1.96e-166	56	540	40	508	Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Penicillium citrinum OX=5077 GN=MSDC PE=1 SV=2
sp|E9CXX8|MNS1B_COCPS	3.35e-164	30	541	19	515	Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) OX=443226 GN=CPSG_02648 PE=1 SV=1
sp|A1CP08|MNS1B_ASPCL	4.36e-160	48	541	27	509	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mns1B PE=3 SV=1
sp|Q2ULB2|MNS1B_ASPOR	2.40e-159	56	540	40	508	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mns1B PE=1 SV=1
sp|B8N417|MNS1B_ASPFN	2.40e-159	56	540	40	508	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mns1B PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.799856	0.200143

TMHMM  Annotations     

Start	End
7	26