CAZyme Information: RVD82571.1

Basic Information

• Species: Arthrobotrys flagrans
• Lineage: Ascomycota; Orbiliomycetes; ; Orbiliaceae; Arthrobotrys; Arthrobotrys flagrans
• CAZyme ID: RVD82571.1
• CAZy Family: CE1
• CAZyme Description: Beta-glucosidase [Source:UniProtKB/TrEMBL;Acc:A0A436ZUE3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
855	SAEB01000009|CGC8	93564.06	4.6573

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflagransCBSH-5679	9927	N/A	30	9897

• Gene Location: location=SAEB01000009:1687260-1689952(+)

Full Sequence      

MDTTTLKEIEETLAQLTLEEKVSLLAGKDFWRTVPVPEKQVPSIKVSDGPSGARGDTFVG
GQKAAFFPSGILMGATFNPDLAYETGELLGEEVKAKSASVLLAPTACCHRSPLGGRNFES
YSEDPLLSGKMASGYIRGVQSRGVAATMKHYAANEQETWRLYVDETIDETTLREIYLKPF
EIAMREGRPWAVMTAYNIINGVHCDSHPFTLKQVLRGEWNYEGLVMSDWFGCNSMVESVL
AGLDLEMPGPARKRPVEKFVEAAEKDETVRKAIDDSARRILTLIAKVGKWKDMTPEAPEY
SRNDPETGNLIRRVGGEGTVLLKNEGKALPLQPGSLKKVAFIGPNAKATVAGGGGSASLE
PNYLTQPYETFVNAIKEINGDIEVPWAQGCNIDRWVPIIDIEGGLCRVGGPGSEAGLFLE
WFHGYEATGEPVSTTVFKTSNAFLWDSRPTSISPLEEFSVKFSGQISVPEDGKYNISLST
ITAAKLYLNGELLIDNWDFKERGNLMMNVGSEEVVKTIELKKGEWYPILVHNSSLWPKDS
PRDPPMEEIGALGIRLGVAPVYDNAALIAQAVEAVKDSDAVVIVVGLNNEWESESYDRSD
TKLPNNQDDLIEEIAKVNQNVIVVNQSGAPVDMPWAENPNVKAIVQAWYAGQEAGNVIAD
VLLGKQNPSGKLPLTFPIKVQDNPSYPYFPGRDQKVEYTEKLMVGYRYYDTENVQTRFPF
GYGLSYSTFSTGEPSLSVAELTEGQSFTATVDVVNTSDVAGAEVVQLYVKRPALASSIKR
PVKELKGFKKVHLGAGETAAANITVDDKSLGIWSVEVKKWVIEAGDYEVLIGTSSVQDGL
KPAGKITIKAAWSWI

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	37	248	6.8e-64	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.04e-86	67	836	120	755	beta-glucosidase BglX.
224389	BglX	9.98e-66	41	392	60	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	1.78e-57	550	706	63	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	4.24e-44	16	832	60	769	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	1.73e-40	67	283	88	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGX47431.1|GH3	0.0	1	855	1	855
EGX50909.1|GH3	3.06e-254	7	854	18	843
QRC98638.1|GH3	4.69e-250	11	855	67	894
CAE7001702.1|GH3	1.94e-244	10	855	70	897
QDS68320.1|GH3	6.78e-243	14	835	31	833

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	8.16e-192	8	835	5	825	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	6.31e-188	8	835	5	825	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	2.23e-139	8	846	4	668	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
2X40_A	1.00e-118	6	841	1	708	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	1.49e-117	6	841	1	708	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	6.93e-205	8	834	10	826	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|P27034|BGLS_RHIRD	4.20e-202	9	836	2	800	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	1.22e-194	8	852	5	835	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	1.41e-193	8	852	5	836	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|Q5BA18|BGLK_EMENI	5.42e-193	8	854	12	835	Probable beta-glucosidase K OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglK PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000045	0.000003

TMHMM  Annotations     

There is no transmembrane helices in RVD82571.1.