CAZyme Information: RVD82567.1

Basic Information

• Species: Arthrobotrys flagrans
• Lineage: Ascomycota; Orbiliomycetes; ; Orbiliaceae; Arthrobotrys; Arthrobotrys flagrans
• CAZyme ID: RVD82567.1
• CAZy Family: CE1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
857		95100.29	6.3907

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflagransCBSH-5679	9927	N/A	30	9897

• Gene Location: location=SAEB01000009:1670029-1672890(-)

Full Sequence      

MQLILDSNTWAEQIVKSLTLEEKISLLSGADVWRTTPIPRVGIPALKTTDGPVGVRGSTV
TDGTTAALTPSAVSLAATFDTDIVEGIGHLLATEVEDKKADVLLAPTVCLHRSPLGGRNF
ESFSGDDPFLGGKLAAAYIRAIQSHGIATSIKHFVANDQETRRFILNQHIPERALREMHL
VPFQIAIREANPWTLMTSYSKINGTYASNNKRLLQGILRDEWGYDGLVISDWFGTNSIVP
SLEAGMDLEMPGPARKRGQKLLDAVRLGHLKERTIEKSAKRVLELVYKTGKHLYPHWIEE
PEEAINRVEHQGFLRMAAADGIVLLKNTNNLLPLRLEPGLQVAFIGPNSRASVAAGGGSA
NLNPHYRTTPYDSFIENANIYAPGAVTVKHAVGCLSNKWVPLVPETCVSPRNGQHGLFME
LFGNTTLSGPAAASSHRKTSMLTCYDNIPKSFTPGKRYSYRATGLITPKTTGRHTFSLGS
CGPSRMLVDGVEIISLWGRTKDSERSELFMAYASPEQRFDMFMEAERTYTLVVEGISREM
DPIPVEYFAELYREEVMDGARVGFMEEVQTDLLGEAVQLARESDVVVMVVGKNVEWESEA
YDMKSMDLPGEQNKLISEVLKANPNTIIVNQSGSPIAMPWIDQASTVLQAWYQGQELGNA
MFDVLTGFVNPNGKLPVTFPKRLEDTPTYHNFPGENDQVFYGEGIWLGYRHYDKAHIEPL
FPFGFGLSYTTFEYSNVRVSSPIFSPHRDVTVSVDVTNTGYLYGKESVQFYVSQISKPGL
PRPVRELKGFAKVALQPGETKTAQYKLDKYALGYFNEKLKKWVVDENAEFEVFAAANSRD
LRGSAIFSIMNGMQWIK

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	38	251	2.4e-62	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.89e-72	70	842	121	758	beta-glucosidase BglX.
224389	BglX	7.43e-71	38	361	55	374	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	3.05e-45	546	709	54	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	9.80e-43	40	285	63	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	1.62e-34	11	808	53	743	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGX47427.1|GH3	0.0	1	857	1	857
UPK89362.1|GH3	0.0	7	856	23	871
UQC77018.1|GH3	0.0	9	856	27	874
QQK45361.1|GH3	0.0	10	855	13	858
QKD62879.1|GH3	0.0	6	856	18	867

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	5.89e-186	12	855	7	842	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.52e-181	12	855	7	842	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	4.72e-147	12	841	6	660	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.99e-113	5	849	1	663	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	1.10e-110	11	849	54	828	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	2.06e-213	12	843	12	832	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|P27034|BGLS_RHIRD	9.80e-192	12	844	3	805	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	7.41e-191	12	856	7	837	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	4.63e-189	12	856	7	837	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|A1DNN8|BGLJ_NEOFI	4.95e-189	12	830	15	837	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999933	0.000104

TMHMM  Annotations     

There is no transmembrane helices in RVD82567.1.