CAZyme Information: RVD82444.1

Basic Information

• Species: Arthrobotrys flagrans
• Lineage: Ascomycota; Orbiliomycetes; ; Orbiliaceae; Arthrobotrys; Arthrobotrys flagrans
• CAZyme ID: RVD82444.1
• CAZy Family: CBM67|GH78
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
395		45225.49	8.1291

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflagransCBSH-5679	9927	N/A	30	9897

• Gene Location: location=SAEB01000009:1247619-1248947(-)

Full Sequence      

MLSVKRAIILSAIVLIVFFFTSSQRSEEFRSHIRGGPRPKVDDDAVPTDPSDHSDKLITQ
INPPHLGKPAPRPSNIRGQPLRDQLAYQFPYDVSNKFPAFIWQTWKYTVANPRFSDGYRP
LEASWTQHHPDFIHEVITDQVALHLIKHLYGSVPNVLEAFTSLPSPILKADFFRYLILLA
RGGIYSDIDTAALKPATRWIPPNFRMASIGLVIGIEADPTGKNWADNYSRRLQFCQWTIQ
SKPGHPVLREVVARITENTLEMKRQGKLKKDQKGVIEFTGPAIWTDTIFDYLNDENYFTV
QKDNPVDFRNFTGMKDPKKIGDVVVLPVTSFSPGVGQFGAGEDDDPQAFVKHMFEGTWKP
EEERHIGEPDNMRAYREDQERKQRERLKKMGIHEV

Enzyme Prediction     

EC	2.4.1.257:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	123	201	1.6e-19	0.8888888888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.96e-47	81	351	66	339	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	5.35e-18	124	201	10	88	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGX45966.1|GT32	3.04e-279	1	395	1	400
QRC95216.1|GT32	8.16e-152	1	368	1	380
ATZ52760.1|GT32	2.89e-150	1	367	1	375
CCD51914.1|GT32	2.89e-150	1	367	1	375
QDS69219.1|GT32	3.19e-150	1	368	1	388

PDB Hits     

RVD82444.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	8.44e-95	81	359	83	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	1.89e-81	82	359	129	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	3.44e-72	81	359	114	388	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	5.74e-72	81	367	80	478	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.198368	0.801592	CS pos: 25-26. Pr: 0.5857

TMHMM  Annotations     

Start	End
7	24