CAZyme Information: RVD81830.1

Basic Information

• Species: Arthrobotrys flagrans
• Lineage: Ascomycota; Orbiliomycetes; ; Orbiliaceae; Arthrobotrys; Arthrobotrys flagrans
• CAZyme ID: RVD81830.1
• CAZy Family: AA9
• CAZyme Description: GH16 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A436ZSC0]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
533		56890.97	10.7086

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflagransCBSH-5679	9927	N/A	30	9897

• Gene Location: location=SAEB01000012:5670837-5672504(-)

Full Sequence      

MTRSFLNNAVFVYSLLAFYADPAHSSLHHRHAHIRRTSALTKRSVPSYDGWSLTFSDDFR
GPANTLPSSSNWLWDLGTSYPGGPSNWGTGEIQTYVKSTSNSYLDGDGNLNIVPIKSSSG
TWTSARMESVGTYRCVPGRKLLIEASIKLPNTPTSSQWGIWPAFWSMGAAFRNNGYDGWP
YTGELDIMEAVNGQGTAYNTIHCGVYPGGVCNEPNGIGHTSPFTKGEFHTFGLVIDRTAG
TWQNEFISWQRDGVEQFRVWGSRIGDEYTWGNLTHLPMFILLNVAIGGALPNAIAGFWTP
TADTIGGLDSAMIIDYVAVYNSLGNDNTSSISYITTTQTSTSSATSRITIQSSSVPTTPR
ASIFVTTTTTTAKTTAKTTTTTTKTTTTTAKTTPKTTAKTTAKTTVKTTAKTTVKTAAKT
TAKTTAKTTAKTTAKTTVKTTAKTTAKTTAKTTAKTTAKTTAKTTAKTTAKTTAKTTAKT
TAKTTAKTTAKTTAKTTAKTAAKTTPKTAAKTTAKTTPKTTARTTAKTTTRKV

Enzyme Prediction     

No EC number prediction in RVD81830.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	56	320	9.1e-49	0.991304347826087

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185691	GH16_Strep_laminarinase_like	5.74e-115	50	321	1	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
185693	GH16_laminarinase_like	3.31e-48	55	320	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185694	GH16_CCF	7.49e-13	88	320	25	329	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.
185689	GH16_fungal_KRE6_glucanase	1.41e-09	142	320	81	294	Saccharomyces cerevisiae KRE6 and related glucanses, member of glycosyl hydrolase family 16. KRE6 is a Saccharomyces cerevisiae glucanase that participates in the synthesis of beta-1,6-glucan, a major structural component of the cell wall. It is a golgi membrane protein required for normal beta-1,6-glucan levels in the cell wall. KRE6 is closely realted to laminarinase, a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
225182	BglS	7.70e-09	142	320	120	263	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGX52676.1|GH16_3	2.75e-227	1	332	1	333
EGX52487.1|GH16_3	2.69e-89	45	312	23	287
ATE52790.1|CBM6|GH16_3	2.80e-83	44	321	33	309
ACU35033.1|CBM6|GH16_3	1.06e-82	44	324	33	312
BCB87142.1|CBM6|GH16_3	1.38e-82	44	324	18	293

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7EO3_A	2.31e-82	44	325	3	283	Chain A, 1,3-beta-glucanase [Actinomycetia bacterium]
3DGT_A	1.78e-69	50	319	8	273	The 1.5 A crystal structure of endo-1,3-beta-glucanase from Streptomyces sioyaensis [Streptomyces sioyaensis]
3ATG_A	5.36e-34	53	327	5	246	endo-1,3-beta-glucanase from Cellulosimicrobium cellulans [Cellulosimicrobium cellulans]
2HYK_A	9.56e-32	52	320	8	242	The crystal structure of an endo-beta-1,3-glucanase from alkaliphilic Nocardiopsis sp.strain F96 [Nocardiopsis sp. F96]
4DFS_A	2.11e-22	41	320	8	262	Structure of the catalytic domain of an endo-1,3-beta-glucanase (laminarinase) from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],4DFS_B Structure of the catalytic domain of an endo-1,3-beta-glucanase (laminarinase) from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9ZG90|KSBGL_SPHMU	1.59e-07	159	320	148	287	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000355	0.999611	CS pos: 25-26. Pr: 0.9681

TMHMM  Annotations     

There is no transmembrane helices in RVD81830.1.