CAZyme Information: RVD81531.1

Basic Information

• Species: Arthrobotrys flagrans
• Lineage: Ascomycota; Orbiliomycetes; ; Orbiliaceae; Arthrobotrys; Arthrobotrys flagrans
• CAZyme ID: RVD81531.1
• CAZy Family: AA9
• CAZyme Description: GPI mannosyltransferase 2 [Source:UniProtKB/TrEMBL;Acc:A0A436ZRI6]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
497	SAEB01000012|CGC15	54441.09	9.3274

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflagransCBSH-5679	9927	N/A	30	9897

• Gene Location: location=SAEB01000012:4690270-4691941(-)

Full Sequence      

MALLTPPEGPAGAVRSLCIIYVIRTLSLLLLAWSTTFLFPSFSPLGYDTSSTHVTGDGNL
IGKGGYITTNFVERLLAALTRWDAIYFASIAKNGHRWEQEWAFGVGQSYLVHGFQWILSL
FGGYEMSPSSQILFLSLCSCGSHLVSAVVLYHLTTVLFETARPKGTSTLGSGETPKVVAF
VAATLHILSPAGIFLVAPYNESVFSVLSFLGYWLYSYAVKNTAFDGQHGLINEASLLLSG
LLFGVSSLFRSNGVINGVLFVFEVSQSFWRLISGTNTAANIRLFLISGVSGALVGIPMVW
RQYQGWLEYCTKEPSIQRMWCSKTLPSIYSFVQSHYWGVGLLKYWTPGNIPLFLLAAPTL
YVLFKTSLNIISVQPPTSTRLYSLDLKHTNKDLLFRLTLPQLLLATLAVTNYHVQIIVRL
SSGLPMWYIVAAAALFQTATTGTKVTESKGSSKSNEGGKTTGEVSSAEASWVRPAVRFFW
GYQVVQAVLYGGFLPPA

Enzyme Prediction     

No EC number prediction in RVD81531.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	37	497	5.5e-100	0.9484029484029484

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	1.76e-31	70	435	48	395	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	1.71e-15	67	429	62	361	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGX50635.1|GT76	0.0	1	497	1	497
CAE7178785.1|GT76	4.59e-77	12	497	13	464
QDS75123.1|GT76	5.41e-76	32	497	22	480
UPK97415.1|GT76	3.22e-75	47	497	38	420
CCT64606.1|GT76	3.55e-72	69	497	53	427

PDB Hits     

RVD81531.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4I0K3|GPI18_GIBZE	1.15e-67	75	497	58	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	1.34e-62	47	497	47	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	4.87e-62	1	497	4	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q2UJS7|GPI18_ASPOR	1.57e-61	79	497	78	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	1.65e-41	44	497	26	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000008	0.000011

TMHMM  Annotations     

Start	End
20	42
132	154
177	199
240	262
283	300
350	372
393	410
414	436