CAZyme Information: RVD80914.1

Basic Information

• Species: Arthrobotrys flagrans
• Lineage: Ascomycota; Orbiliomycetes; ; Orbiliaceae; Arthrobotrys; Arthrobotrys flagrans
• CAZyme ID: RVD80914.1
• CAZy Family: AA7
• CAZyme Description: Beta-glucosidase [Source:UniProtKB/TrEMBL;Acc:A0A436ZPU4]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
846		92439.84	5.1577

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflagransCBSH-5679	9927	N/A	30	9897

• Gene Location: location=SAEB01000012:2639939-2642768(-)

Full Sequence      

MVGQKSVKSEPEFKEEEEAKLKSLVSKLSEENKILLLSGKDFWRTQPLPELNVGSLKTTD
GPNGARGEFFTDGTPAALFPCGISLAATWNVDLLHEVGSTLAKEAKAKQAQVLLAPTVCL
HRSPLGGRNFESFSEDPLLTGKLAAAYINGLQGEGVAATIKHFVANEQETLRMQINSVVE
ERALRELYLKPFEIAIRDANPWALMSSYNLINGLHADMNPFTLRKVLREEWRYKGAVISD
WGGTNSTVESVKAGCDLEMPGPAKLRGKVLKAALDRGDITIQDIDESVERILRLLHRTNR
FEAPVDEPGEKTLDTEETRQLIRRAGIEGITLLKNDNKALPLGPEIKKIALIGPNVKRAI
AGGGGSASLKPYYNTTPYDSIAAVSGREILFAQGAQIDKWLPLASNICKTPSGQPGVVLE
FFKGDKFGDVPLIVQTRAKTDLFLWDSAPVEVLPAYSFKVKTIIVPETTGEHQFGFQSVG
PGRLFINKQLLIDNWNWTEAGEAMFEASVEVVASIHLNAGVPVEILVESTNETRPAGKAD
APAHGYGGCRIGYRESPTVDFIQEAADIATQADAAIVIVGLDAEWESEGYDRQTMDLPKD
GSQDRLVSAIAKANKRTIVVNQSGSPVTMPWVDEVPAILQAWYQGQEAGNALADILFGNE
TPSGKLPVTFPKRLKDNPAYHNWPGENKRVVYGEGIYIGYKHYERIALDVLFPFGHGLSY
TQFQYGDVKISGSVLNGSNSLTVSVSVTNKGQVSGQEIVQLYVRDTKSRLPRPAKELQGF
SKLTLNSGETKIASISIDMYSVGYYDTSIPGWIAEAGEFEAVIGSSSEDIRGAASFRVEE
SFSWTF

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	50	260	1.2e-66	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.02e-94	79	836	120	762	beta-glucosidase BglX.
224389	BglX	1.33e-72	51	367	58	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	2.30e-61	330	700	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	3.90e-55	23	798	55	743	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	6.30e-44	64	294	76	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGX50909.1|GH3	0.0	1	846	1	845
QDS68320.1|GH3	0.0	34	831	39	837
CAE7001702.1|GH3	0.0	20	846	68	898
QRC98638.1|GH3	0.0	20	846	64	895
APA09558.1|GH3	0.0	24	846	59	887

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	7.98e-202	21	844	6	842	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.77e-197	21	844	6	842	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	3.01e-156	21	841	5	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.22e-124	25	834	9	659	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	6.80e-116	45	840	43	715	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	3.01e-227	13	839	3	839	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|B0Y3M6|BGLI_ASPFC	7.25e-215	25	844	10	835	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	2.89e-214	25	844	10	835	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|Q2U9M7|BGLH_ASPOR	5.75e-214	24	844	8	824	Probable beta-glucosidase H OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglH PE=3 SV=2
sp|Q5BA18|BGLK_EMENI	1.63e-213	33	845	25	836	Probable beta-glucosidase K OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglK PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000077	0.000002

TMHMM  Annotations     

There is no transmembrane helices in RVD80914.1.