CAZyme Information: RVD80564.1

Basic Information

• Species: Arthrobotrys flagrans
• Lineage: Ascomycota; Orbiliomycetes; ; Orbiliaceae; Arthrobotrys; Arthrobotrys flagrans
• CAZyme ID: RVD80564.1
• CAZy Family: AA3|CBM1
• CAZyme Description: Alpha-L-rhamnosidase [Source:UniProtKB/TrEMBL;Acc:A0A436ZNT5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
989		110264.46	5.4977

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflagransCBSH-5679	9927	N/A	30	9897

• Gene Location: location=SAEB01000012:1559612-1562794(+)

Full Sequence      

MANRQPLEITNLRLSNTSNLLGVDDPAPPISWCYSSPHSSHGWWQQTYVLSLRSWDIGDT
PEVDSLKPISILGPRTLRSENIPWPKAFPRVEPGRVYELSVVGVLTRHDKCEYFTLKLRD
GWEFGTLEGDIPRPADVSPLALAEELGKLENAAFDTAMTAAVLVFEGTLVGGFETWCERA
DGVMPISTPWDLDGWEKPKPVSVFRTSFTVGTLSAARLHVTAFGVYKIFINGRAISQSTM
DPGWTEYKLRICYQTYDVYKYFIPGENVVTVFVADGWYRGRLASGGEARRGIFGKETGFV
SIIEIYKPSGGKEIVKTGSTASTGWKCTRRCPIRQTEIYDGEQYDSRINIDDISDQANIW
EDVKVMTDIWQTSSTPTLQASIAPPITCTELLSVQQYITSPTGKTILDFGQNTAGRVRIK
GSAPSGTRVTFVHVEVLEPDGTPCTGLLREAKATDSYIFNGSGVEEWEPEFTFHGFRYVQ
VDPWIEGLEVTAKVYGSNLPTGLMKFKSSHGELNRLVENIRWSARANFLSICTDCPQRDE
RMGWTGDINAFGPTAVYIFDCQTFLRSWLQGLVDGQNLGGRSCPPLVSPNALYMPGSHRP
TALWQDVLVTLPWYLYQTYGDTSLLKELYSSMVDYQTKGIPKDPRTGLWAASFQFGDWLD
PTAPPERPDLPATHPMFVANTWLCNITNTLWKITTVLQDQDGIREWKAAALNLKSKWQAQ
YILPIASRLTDLGITEPPKILTQDTQTAYSLALNFRLLPNDLVKLAINRLHHLVINNNCH
LSTGFAGTPELLHAICASPSSPLSLEENLASISLAYKVLLGPRTPPSWLYPVTMGATTIW
ERWDAVKPDGSVNTSGMTSLNHYAYGSVGRWIFETVGGIKMRYNGNQEEGLTFIFNPIPN
LEHGITWSEMVYNSPKGIVACNWKYESDSQKIVTEIVLPGNCDGEVMVLGQPLKRVGAGK
WILTTSVKDSELQLLQKKIDDLSEGWVMV

Enzyme Prediction     

EC	3.2.1.40:1	3.2.1.40:8	3.1.1.73:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	399	947	1.1e-127	0.9920634920634921
CBM67	196	352	1.1e-17	0.7954545454545454

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	1.07e-96	506	876	6	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
400715	Bac_rhamnosid_N	1.67e-38	211	390	1	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
336149	Bac_rhamnosid	1.01e-33	398	484	1	87	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
379972	Bac_rhamnosid_C	0.005	892	960	11	75	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGX51590.1|GH78	0.0	1	989	1	988
EGX54175.1|GH78	1.22e-315	7	976	5	976
ALV31770.1|GH78	4.13e-164	178	960	107	852
ABY33611.1|GH78	2.26e-159	12	970	18	872
QKD48510.1|GH78	3.80e-159	7	964	4	859

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GSZ_A	2.35e-141	155	962	92	860	Crystal structure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
3W5M_A	2.58e-112	186	948	283	994	Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6I60_A	1.33e-81	203	948	178	898	Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q82PP4|RHA78_STRAW	1.03e-111	186	948	283	994	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
sp|T2KNB2|PLH20_FORAG	2.00e-97	216	948	190	878	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
sp|P9WF03|RHA78_ALTSL	1.47e-92	145	945	137	875	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
sp|T2KPL4|PLH28_FORAG	2.47e-49	186	948	173	906	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000032	0.000000

TMHMM  Annotations     

There is no transmembrane helices in RVD80564.1.